[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrbG
DDBJ      :yrbG         conserved hypothetical protein
Swiss-Prot:YRBG_BACSU   RecName: Full=UPF0702 transmembrane protein yrbG;

Homologs  Archaea  1/68 : Bacteria  239/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   94->203 3c6fD PDBj 4e-11 27.3 %
:RPS:PDB   94->218 3c6fA PDBj 2e-18 25.6 %
:RPS:PFM   88->150 PF04239 * DUF421 3e-12 52.4 %
:HMM:PFM   87->197 PF04239 * DUF421 2.4e-30 42.9 98/99  
:HMM:PFM   8->85 PF11877 * DUF3397 0.00022 22.4 76/116  
:BLT:SWISS 1->218 YRBG_BACSU e-121 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14728.1 GT:GENE yrbG GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2831124..2831780) GB:FROM 2831124 GB:TO 2831780 GB:DIRECTION - GB:GENE yrbG GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14728.1 GB:DB_XREF GOA:O32050 InterPro:IPR007353 SubtiList:BG13786 UniProtKB/Swiss-Prot:O32050 GB:GENE:GENE yrbG LENGTH 218 SQ:AASEQ MEELLTIAFRTVVLYFVILVIFRFMGKREIGELSILDLVVFIMMAEIAVLAIENVDDHLFHTILPMLVLMIIQVTLAYFSLKNRKVRQLLDGKPTIIIKYGKIDEEAMKSQRYNFDDLMVQLRENSIDRVADVSFAILEPSGKLTIVKKENSGEHRQLEMPLIIDGFIQTENLSRISKDRKWLLESLQKHGYTNPSDISFCSFTDGEIYIDEKDGHRT GT:EXON 1|1-218:0| SW:ID YRBG_BACSU SW:DE RecName: Full=UPF0702 transmembrane protein yrbG; SW:GN Name=yrbG; OrderedLocusNames=BSU27680; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->218|YRBG_BACSU|e-121|100.0|218/218| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 4->26| TM:REGION 31->53| TM:REGION 59->81| BL:PDB:NREP 1 BL:PDB:REP 94->203|3c6fD|4e-11|27.3|110/138| RP:PDB:NREP 1 RP:PDB:REP 94->218|3c6fA|2e-18|25.6|125/137| RP:PFM:NREP 1 RP:PFM:REP 88->150|PF04239|3e-12|52.4|63/80|DUF421| HM:PFM:NREP 2 HM:PFM:REP 87->197|PF04239|2.4e-30|42.9|98/99|DUF421| HM:PFM:REP 8->85|PF11877|0.00022|22.4|76/116|DUF3397| OP:NHOMO 412 OP:NHOMOORG 241 OP:PATTERN ----------------------------------------------1--------------------- --1--1-1-------------------------111---1-------------------------1----1-------11--------------------1211---5-1-------------------------------------11------------------111--------------1------13444444456347555738552574522152--------44--------------------111-11--1-111111111-11-111-------111111111-1-1--------------1---------24253222335313131222111121--2--2133352242111111-11--1------1---------------------------21-1-1-11-1---------1111-------12112------------------------------------------------------1---1-------------1----------11---------2111--------1-------------1------------1---------------1-1----------------------------------------1------------------------1--------------211111111111-1111111111111111111121----11111111111111111-111---1--1----------------111--------1----------------11111---12-------1----1--1--1------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 57.3 SQ:SECSTR #############################################################################################cEEEEETTEEcHHHHHHTTccHHHHHHHHHHTTcccGGGEEEEEEcTTccEEEEEcGGGcccccccEEEEETTEEcHHHHHHHcccHHHHHHHHHHTTcccGGGEEEEEEcTcccEEEETTTTTc DISOP:02AL 148-159, 215-218| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHccccHHHHHHHHHHcccccHHHcEEEEEEccccEEEEEcccccccccccEEEEEccEEHHHHHHHccccHHHHHHHHHHcccccHHHEEEEEEEccEEEEEEcccccc //