[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrdA
DDBJ      :yrdA         conserved hypothetical protein
Swiss-Prot:YRDA_BACSU   RecName: Full=Uncharacterized protein yrdA;

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->150 3di5A PDBj 2e-43 56.2 %
:RPS:PDB   2->150 3di5A PDBj 2e-21 54.2 %
:RPS:SCOP  1->145 1rxqA  a.213.1.1 * 3e-13 13.9 %
:HMM:SCOP  7->154 2f22A1 a.213.1.2 * 5.2e-32 25.5 %
:RPS:PFM   9->148 PF05163 * DinB 5e-12 31.4 %
:HMM:PFM   1->160 PF05163 * DinB 1.2e-48 30.0 160/169  
:BLT:SWISS 1->167 YRDA_BACSU 4e-97 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14619.1 GT:GENE yrdA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2734953..2735456) GB:FROM 2734953 GB:TO 2735456 GB:DIRECTION - GB:GENE yrdA GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14619.1 GB:DB_XREF GOA:O07079 InterPro:IPR007837 SubtiList:BG12281 UniProtKB/Swiss-Prot:O07079 GB:GENE:GENE yrdA LENGTH 167 SQ:AASEQ MFQTLDHFLKSWEFEADATQKLLNSLTDESLKQEITSQNWTLGRIAWHTVAAIGIITSNTDLTFQAPAEDYPVPTSAQFIADSYHQASNAFVQALKTQWTDHTLQERINFIGQQMPNGSLLMFLIQHQNHHRGQMTVLMRQAGLTVPGIYGPAKEEWAKFGLEAPKM GT:EXON 1|1-167:0| SW:ID YRDA_BACSU SW:DE RecName: Full=Uncharacterized protein yrdA; SW:GN Name=yrdA; OrderedLocusNames=BSU26780; SW:KW Complete proteome; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|YRDA_BACSU|4e-97|100.0|167/167| GO:SWS:NREP 1 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| BL:PDB:NREP 1 BL:PDB:REP 2->150|3di5A|2e-43|56.2|144/144| RP:PDB:NREP 1 RP:PDB:REP 2->150|3di5A|2e-21|54.2|144/144| RP:PFM:NREP 1 RP:PFM:REP 9->148|PF05163|5e-12|31.4|140/157|DinB| HM:PFM:NREP 1 HM:PFM:REP 1->160|PF05163|1.2e-48|30.0|160/169|DinB| RP:SCP:NREP 1 RP:SCP:REP 1->145|1rxqA|3e-13|13.9|144/174|a.213.1.1| HM:SCP:REP 7->154|2f22A1|5.2e-32|25.5|141/0|a.213.1.2|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 31 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1---2-----------------------------------------------------------------------------------111111111111111111---1111--121----------1-------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 89.2 SQ:SECSTR #cccHHHHHHHHHHHHHHHHHHHHHccTTGGGccccTTcccHHHHHHHHHHHHHHHHGGGTcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccGGGGGcEEEETTHcEEEHHHHHHHHHHHHHHHHHHHHHHHHTTccccccc################# DISOP:02AL 166-167| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccc //