[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrdB
DDBJ      :yrdB         putative integral inner membrane protein
Swiss-Prot:YRDB_BACSU   RecName: Full=Uncharacterized protein yrdB;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->108 PF10823 * DUF2568 1e-08 37.0 %
:HMM:PFM   9->108 PF10823 * DUF2568 3.5e-32 47.3 93/93  
:BLT:SWISS 1->123 YRDB_BACSU 4e-66 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14618.1 GT:GENE yrdB GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2733772..2734143) GB:FROM 2733772 GB:TO 2734143 GB:DIRECTION - GB:GENE yrdB GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB14618.1 GB:DB_XREF GOA:O07080 SubtiList:BG12282 UniProtKB/Swiss-Prot:O07080 GB:GENE:GENE yrdB LENGTH 123 SQ:AASEQ MEKLNQTNLLLRFTLEIAALISLGVYAWISFNGYFKYVLTLVLPIAVMIVWSVFAVPHDPSRSGQTVIAVNGVTRLVIELLIFAMAVAALYFSYLKPVSIVFLCLIILHYIISAERIKWLLNQ GT:EXON 1|1-123:0| SW:ID YRDB_BACSU SW:DE RecName: Full=Uncharacterized protein yrdB; SW:GN Name=yrdB; OrderedLocusNames=BSU26770; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->123|YRDB_BACSU|4e-66|100.0|123/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 8->30| TM:REGION 37->58| TM:REGION 65->87| TM:REGION 93->115| RP:PFM:NREP 1 RP:PFM:REP 10->108|PF10823|1e-08|37.0|92/94|DUF2568| HM:PFM:NREP 1 HM:PFM:REP 9->108|PF10823|3.5e-32|47.3|93/93|DUF2568| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //