[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrdC
DDBJ      :yrdC         putative hydrolase
Swiss-Prot:YRDC_BACSU   RecName: Full=Uncharacterized isochorismatase family protein yrdC;         EC=3.-.-.-;

Homologs  Archaea  15/68 : Bacteria  207/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->180 3irvA PDBj 3e-15 28.8 %
:RPS:PDB   3->175 2a67A PDBj 8e-32 22.2 %
:RPS:SCOP  3->180 1nf8A  c.33.1.3 * 3e-33 18.1 %
:HMM:SCOP  1->181 1nbaA_ c.33.1.3 * 5.7e-44 32.9 %
:RPS:PFM   6->143 PF00857 * Isochorismatase 3e-13 36.8 %
:HMM:PFM   6->178 PF00857 * Isochorismatase 4.4e-34 33.3 162/174  
:BLT:SWISS 1->187 YRDC_BACSU e-107 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14617.1 GT:GENE yrdC GT:PRODUCT putative hydrolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2732980..2733543) GB:FROM 2732980 GB:TO 2733543 GB:DIRECTION - GB:GENE yrdC GB:PRODUCT putative hydrolase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14617.1 GB:DB_XREF GOA:O07081 InterPro:IPR000868 SubtiList:BG12283 UniProtKB/Swiss-Prot:O07081 GB:GENE:GENE yrdC LENGTH 187 SQ:AASEQ MEEKKALIIVDVQKAFDDKKWGERNNVKAEENISKILELWREKGWTVIYIQHTSDKPHSLFHPKNEGFAIKEIVKPMDEEVIITKTVNSSFIGTNLEEFLKLNEITTVVITGLTTPHCVSTTTRMSGNLGFDTYLISDATAAFGMRDQNDTYYDAATIHNISLATLHDEFATILTTDQLINDFIKTH GT:EXON 1|1-187:0| SW:ID YRDC_BACSU SW:DE RecName: Full=Uncharacterized isochorismatase family protein yrdC; EC=3.-.-.-; SW:GN Name=yrdC; OrderedLocusNames=BSU26760; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|YRDC_BACSU|e-107|100.0|187/187| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 4->180|3irvA|3e-15|28.8|177/213| RP:PDB:NREP 1 RP:PDB:REP 3->175|2a67A|8e-32|22.2|162/163| RP:PFM:NREP 1 RP:PFM:REP 6->143|PF00857|3e-13|36.8|136/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 6->178|PF00857|4.4e-34|33.3|162/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 3->180|1nf8A|3e-33|18.1|166/207|c.33.1.3| HM:SCP:REP 1->181|1nbaA_|5.7e-44|32.9|170/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 393 OP:NHOMOORG 262 OP:PATTERN ------------------1-----11111-11-----------11-11----1-----1---2----- -21-1----------------1---1-------111-----1--1-------2-----------1-1-11-------------------------------1------------------------------------------1-----------------------------------------1111---1333334231463456----12344---1-1111111-11----1--1-------1------1--------------1----1-11-------1-1-------------------------------------12111----1-1-111-----------1---------------------2-----------211------------------1-11211111-1--2223323122111-1---1-------1---------------1----------------------------------111111233341-----1111-----22112222--11--11--11-23---1-11-21-----------1---1-------2111-111-111-1-----1-11--------------------------11----1-----1111----1--1-----1---1--1--------1--11------------------------------------------------------2---------1--------------------------111---------------11111-11121-23222443-2222-433------------1------1-------------------------------------------------------------------11------1- ----13--------111-22212211-------1111------1-133-11-12-21-------1-------11------------------1-----1----1-3-1--------------------------------------------------1----1-1----------1---------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 97.9 SQ:SECSTR cTccEEEEEEcccTTccccccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEccTTTcTTccTTcTTTcccTTccccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEccccccccHHHHHHHHHHHHHHHHHHcTTTcEEccTTcccTTH#### DISOP:02AL 1-2| PSIPRED cccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccHHHccccccEEEEcccccccccccHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEcHHHHHHHHHHcc //