[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrhD
DDBJ      :yrhD         conserved hypothetical protein
Swiss-Prot:YRHD_BACSU   RecName: Full=Uncharacterized protein yrhD;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   119->155 PF07849 * DUF1641 2e-07 54.1 %
:HMM:PFM   116->156 PF07849 * DUF1641 1.9e-20 53.7 41/42  
:HMM:PFM   24->115 PF05649 * Peptidase_M13_N 0.00028 18.4 87/388  
:BLT:SWISS 31->160 YRHD_BACSU 7e-69 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14665.1 GT:GENE yrhD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2784170..2784652 GB:FROM 2784170 GB:TO 2784652 GB:DIRECTION + GB:GENE yrhD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 10913079 GB:PROTEIN_ID CAB14665.1 GB:DB_XREF InterPro:IPR012440 SubtiList:BG12293 UniProtKB/Swiss-Prot:O05396 GB:GENE:GENE yrhD LENGTH 160 SQ:AASEQ MATPITTIKKETKTAEQIKLEKIEELKELLAENEDAVSKTMTLMNELNDLGIFDAATSMLRAKEDIAKIALGQVSREPVTNLINTMMAAGGALTKADPEFTAKLLESVMAGTEQAQSFLKEDKKVGILDLLKAMNDPDINRAVGFGLQFLKGMGKELREQ GT:EXON 1|1-160:0| SW:ID YRHD_BACSU SW:DE RecName: Full=Uncharacterized protein yrhD; SW:GN Name=yrhD; OrderedLocusNames=BSU27230; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 31->160|YRHD_BACSU|7e-69|100.0|130/160| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 23->48| SEG 2->16|atpittikketktae| SEG 18->30|iklekieelkell| RP:PFM:NREP 1 RP:PFM:REP 119->155|PF07849|2e-07|54.1|37/41|DUF1641| HM:PFM:NREP 2 HM:PFM:REP 116->156|PF07849|1.9e-20|53.7|41/42|DUF1641| HM:PFM:REP 24->115|PF05649|0.00028|18.4|87/388|Peptidase_M13_N| OP:NHOMO 46 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1112122221222222--11-12211111---111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 13-21, 117-121, 157-160| PSIPRED ccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //