[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrhF
DDBJ      :yrhF         conserved hypothetical protein
Swiss-Prot:YRHF_BACSU   RecName: Full=Uncharacterized protein yrhF;

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PFM   6->111 PF10057 * DUF2294 2e-15 45.7 %
:HMM:PFM   4->114 PF10057 * DUF2294 5.5e-39 40.9 110/118  
:BLT:SWISS 1->122 YRHF_BACSU 1e-65 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14663.1 GT:GENE yrhF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2780525..2780893) GB:FROM 2780525 GB:TO 2780893 GB:DIRECTION - GB:GENE yrhF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14663.1 GB:DB_XREF InterPro:IPR018745 SubtiList:BG12295 UniProtKB/Swiss-Prot:O05398 GB:GENE:GENE yrhF LENGTH 122 SQ:AASEQ MSKKIHEFNDIIRKLRKELFGKGPERIHTVFVENMAVSTLYGNLSASEQFIARTPEGREMVHAARTSLIQDLYSKQTPEGMEELMGAKLVHLFSDIKIEENIAVSVFVFDRKIDEQKEALQS GT:EXON 1|1-122:0| SW:ID YRHF_BACSU SW:DE RecName: Full=Uncharacterized protein yrhF; SW:GN Name=yrhF; OrderedLocusNames=BSU27210; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|YRHF_BACSU|1e-65|100.0|122/100| RP:PFM:NREP 1 RP:PFM:REP 6->111|PF10057|2e-15|45.7|105/115|DUF2294| HM:PFM:NREP 1 HM:PFM:REP 4->114|PF10057|5.5e-39|40.9|110/118|DUF2294| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111-111111-111-111-1111---------1--111111-11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 63.9 SQ:SECSTR ###########################################EEEcccEEEEcTTcEEEEEEEEEccccEEEEEEccGGGTTTTcccccEEEEcEEEcTTcEEcccccHHHHHHHTcccc# DISOP:02AL 1-6, 117-122| PSIPRED ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcEEEEEEEEcccHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHcc //