[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrhH
DDBJ      :yrhH         putative methyltransferase
Swiss-Prot:YRHH_BACSU   RecName: Full=Putative methyltransferase yrhH;         EC=2.1.1.-;

Homologs  Archaea  1/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:180 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   30->140 1xxlA PDBj 2e-09 28.4 %
:RPS:PDB   1->177 3c3pA PDBj 4e-15 11.0 %
:RPS:SCOP  5->166 1qzzA2  c.66.1.12 * 2e-15 14.9 %
:HMM:SCOP  10->167 1yubA_ c.66.1.24 * 1.2e-20 20.6 %
:RPS:PFM   31->140 PF01209 * Ubie_methyltran 2e-09 29.4 %
:HMM:PFM   43->140 PF08241 * Methyltransf_11 9.3e-19 26.3 95/95  
:HMM:PFM   124->167 PF01555 * N6_N4_Mtase 0.0005 32.6 43/231  
:BLT:SWISS 1->180 YRHH_BACSU e-102 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14660.1 GT:GENE yrhH GT:PRODUCT putative methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2777877..2778419) GB:FROM 2777877 GB:TO 2778419 GB:DIRECTION - GB:GENE yrhH GB:PRODUCT putative methyltransferase GB:FUNCTION 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15870467; Product type pe : putative enzyme GB:PROTEIN_ID CAB14660.1 GB:DB_XREF GOA:O05400 InterPro:IPR013216 SubtiList:BG12297 UniProtKB/Swiss-Prot:O05400 GB:GENE:GENE yrhH LENGTH 180 SQ:AASEQ MLENRLYKRSDFWKLFSRKYKLTKTIEHMMIDSIDIQENDRILEIGIGNGTVFKSITKKLKKGSLKSIDPSKRKVRQISRANRKNMGNGEVFHGYPEDIPFDDRTFNKVFSLHTVQSCTDIRLALREIYRVLQIDGRFYISIDTNTGEKEKTYIQLLKDQHFRDLSVIRRASCLCIVAVK GT:EXON 1|1-180:0| SW:ID YRHH_BACSU SW:DE RecName: Full=Putative methyltransferase yrhH; EC=2.1.1.-; SW:GN Name=yrhH; OrderedLocusNames=BSU27180; SW:KW Complete proteome; Methyltransferase; Stress response; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|YRHH_BACSU|e-102|100.0|180/180| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006950|"GO:response to stress"|Stress response| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 30->140|1xxlA|2e-09|28.4|109/231| RP:PDB:NREP 1 RP:PDB:REP 1->177|3c3pA|4e-15|11.0|172/192| RP:PFM:NREP 1 RP:PFM:REP 31->140|PF01209|2e-09|29.4|109/234|Ubie_methyltran| HM:PFM:NREP 2 HM:PFM:REP 43->140|PF08241|9.3e-19|26.3|95/95|Methyltransf_11| HM:PFM:REP 124->167|PF01555|0.0005|32.6|43/231|N6_N4_Mtase| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 5->166|1qzzA2|2e-15|14.9|161/249|c.66.1.12| HM:SCP:REP 10->167|1yubA_|1.2e-20|20.6|155/245|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN --------------------------------1----------------------------------- ---------------------------------------------------------------------------------------------------------1------------------------1-----------11------------------------1------------------------1------1----------1111--1--1---------------------------------------------11-------------------1-------------------------------------------1111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 100.0 SQ:SECSTR HHHHTcccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEEccGGGHHHHHHHTTccTTcEEEEEccHHHHHTTccHHHHHHHHcGGGGEEEEEccHHHHHTTcccEEEEEETTTccHHHHHHHGGGEEEEEEEEEEccccccccccHHHHHHTTcTTEEEEEEccTTcEEEEEEc PSIPRED ccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHccccccEEEEccHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHccccEEEEEEEcccEEEEEEc //