[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrhK
DDBJ      :yrhK         conserved hypothetical protein
Swiss-Prot:YRHK_BACSU   RecName: Full=Uncharacterized protein yrhK;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->86 PF03741 * TerC 9.9e-05 20.8 53/184  
:HMM:PFM   4->52 PF03904 * DUF334 0.00018 40.5 42/230  
:BLT:SWISS 1->96 YRHK_BACSU 4e-46 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14657.1 GT:GENE yrhK GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2773356..2773646 GB:FROM 2773356 GB:TO 2773646 GB:DIRECTION + GB:GENE yrhK GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14657.1 GB:DB_XREF GOA:O05401 SubtiList:BG12300 UniProtKB/Swiss-Prot:O05401 GB:GENE:GENE yrhK LENGTH 96 SQ:AASEQ MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFAIGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD GT:EXON 1|1-96:0| SW:ID YRHK_BACSU SW:DE RecName: Full=Uncharacterized protein yrhK; SW:GN Name=yrhK; OrderedLocusNames=BSU27150; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->96|YRHK_BACSU|4e-46|100.0|96/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 26->48| TM:REGION 54->76| SEG 64->75|llllirptirli| HM:PFM:NREP 2 HM:PFM:REP 34->86|PF03741|9.9e-05|20.8|53/184|TerC| HM:PFM:REP 4->52|PF03904|0.00018|40.5|42/230|DUF334| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-9, 86-96| PSIPRED ccccccHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //