[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrpB
DDBJ      :yrpB         putative anionic nitroalkane dioxygenase
Swiss-Prot:2NPD_BACSU   RecName: Full=Probable 2-nitropropane dioxygenase;         Short=2-NPD;         EC=1.13.11.32;AltName: Full=Nitroalkane oxidase;

Homologs  Archaea  1/68 : Bacteria  478/915 : Eukaryota  107/199 : Viruses  0/175   --->[See Alignment]
c.1.4c.1.5
:347 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->329 3bw2A PDBj 1e-35 31.4 %
:RPS:PDB   13->334 3bw4A PDBj 6e-67 35.4 %
:RPS:SCOP  7->270 1al7A  c.1.4.1 * 8e-18 17.6 %
:HMM:SCOP  5->345 1zfjA1 c.1.5.1 * 4.3e-57 26.1 %
:RPS:PFM   13->343 PF03060 * NPD 2e-56 44.3 %
:HMM:PFM   4->343 PF03060 * NPD 1.4e-116 43.1 320/323  
:BLT:SWISS 1->347 2NPD_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14621.1 GT:GENE yrpB GT:PRODUCT putative anionic nitroalkane dioxygenase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2736915..2737958 GB:FROM 2736915 GB:TO 2737958 GB:DIRECTION + GB:GENE yrpB GB:PRODUCT putative anionic nitroalkane dioxygenase GB:FUNCTION 16.8: Protect 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 9501443; Product type pe : putative enzyme GB:PROTEIN_ID CAB14621.1 GB:DB_XREF GOA:O05413 InterPro:IPR013785 SubtiList:BG12305 UniProtKB/Swiss-Prot:O05413 GB:GENE:GENE yrpB LENGTH 347 SQ:AASEQ MNEFMKKFSLTKPIIQAPMAGGITKPRLASAVSNQGALGSLASGYLTPDLLEQQIKEIFELTDAPFQINVFVPLGLEMPPKDQIKKWKENIPLANQVNQFTSVQEEWDDFYQKIDLILKYKVKACSFTFDLPPEDAVKELKTAGCCLIGTASTVEEALLMEERGMDIVVLQGSEAGGHRGAFLPSKGESAVGLMALIPQAADALSVPVIAAGGMIDHRGVKAALTLGAQGVQIGSAFLICHESNAHPVHKQKILEANEADTKLTTLFSGKEARGIVNKWMEENEQFETQTLPYPYQNTLTKAMRQKASLQNNHDQMSLWAGQGIRSLTEEISVKQLLNQLCQEDIKI GT:EXON 1|1-347:0| SW:ID 2NPD_BACSU SW:DE RecName: Full=Probable 2-nitropropane dioxygenase; Short=2-NPD; EC=1.13.11.32;AltName: Full=Nitroalkane oxidase; SW:GN Name=yrpB; OrderedLocusNames=BSU26800; SW:KW Complete proteome; Dioxygenase; FAD; Flavoprotein; FMN;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->347|2NPD_BACSU|0.0|100.0|347/347| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 13->329|3bw2A|1e-35|31.4|309/347| RP:PDB:NREP 1 RP:PDB:REP 13->334|3bw4A|6e-67|35.4|319/347| RP:PFM:NREP 1 RP:PFM:REP 13->343|PF03060|2e-56|44.3|296/312|NPD| HM:PFM:NREP 1 HM:PFM:REP 4->343|PF03060|1.4e-116|43.1|320/323|NPD| GO:PFM:NREP 2 GO:PFM GO:0018580|"GO:2-nitropropane dioxygenase activity"|PF03060|IPR004136| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03060|IPR004136| RP:SCP:NREP 1 RP:SCP:REP 7->270|1al7A|8e-18|17.6|255/350|c.1.4.1| HM:SCP:REP 5->345|1zfjA1|4.3e-57|26.1|314/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 998 OP:NHOMOORG 586 OP:PATTERN -----------------------1-------------------------------------------- 11--22-1111-1143244-45--3543444244444567-1----------1111-1--112-2212111--------114--11-11111-1-----112111411-1------------------------------------1--1---------------------------------11---11--11111111111111111-21111111123221-22222211-111111111111111--211---11-1---11-----1-11111-11121111211111111111111111111111111111111111-22222222222122-211111111---11222221--2-211111-1111--3224-----1141221-22321------------1111151-1-7-1---1--1111-22-4--11-----12222222222111112111111---1----------------1111-23242122163335652221144542222327323465--1221-13321112-111----1------------1-14-11111-111111---------11-121---1111111111---------11111--11--2---21111111---1111111-1-1--------------------------------------------------122----------1--11-------------------------------------1111-1-111112-------1---2221212111-122221111111111111--------------------1---11-1-11--11111--1-111111----------1-------------------------1222211111-1- ----111-11--11254424242535333232333433232333335523345313233333111-1--1--1-111111111111---67342321-1--13111--22--------------------------------------------------------------------17111--1131321111123- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 98.8 SQ:SECSTR ccHHHHTccccccEEEcccTTTTccHHHHHHHHHTTccEEEEcTTccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHTHHHHHHTTccccccTTccccTTHHHHHHHHHHccccEEEEEcccccHHHHHHHHHTTcEEEEEEccHHHHHHHHHTTccEEEEEcTTccEEccccccGGTTccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHTTccEEEEcHHHHTcTTccccHHHHHHTTcGGGccEEEEcTTTcccEEEEccHHHHHHGGGccccccTTHHHHHHHHHHHHHHHHTcGGGccccccTTGGGcccccHHHHHHHHHHHH#### PSIPRED ccHHHHHHcccccEEEcccccccccHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHccccEEcccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEEcccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccHHHccccccccHHHHHHHHHcccccEEEEEcccccEEHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccEEccHHHHHHcccccHHHHHHHHHHHHHHc //