[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrpC
DDBJ      :yrpC         glutamate racemase
Swiss-Prot:MURI2_BACSU  RecName: Full=Glutamate racemase 2;         EC=5.1.1.3;

Homologs  Archaea  1/68 : Bacteria  774/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.37.1c.78.2
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->248 2gzmB PDBj 5e-37 32.4 %
:RPS:PDB   3->236 2dwuA PDBj 5e-38 31.9 %
:RPS:SCOP  1->100 1b73A1  c.78.2.1 * 8e-17 43.0 %
:RPS:SCOP  92->194 1iu9A  c.78.2.1 * 3e-14 11.1 %
:RPS:SCOP  177->265 2eyqA3  c.37.1.19 * 7e-04 35.1 %
:HMM:SCOP  1->104 1b74A1 c.78.2.1 * 1.5e-36 49.0 %
:HMM:SCOP  107->251 1b74A2 c.78.2.1 * 1.7e-24 31.6 %
:RPS:PFM   3->197 PF01177 * Asp_Glu_race 2e-20 39.0 %
:HMM:PFM   3->213 PF01177 * Asp_Glu_race 2.7e-37 29.4 197/217  
:BLT:SWISS 1->265 MURI2_BACSU e-152 100.0 %
:PROS 67->75|PS00923|ASP_GLU_RACEMASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14622.1 GT:GENE yrpC GT:PRODUCT glutamate racemase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2738308..2739105 GB:FROM 2738308 GB:TO 2739105 GB:DIRECTION + GB:GENE yrpC GB:PRODUCT glutamate racemase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15347750; Product type e: enzyme GB:PROTEIN_ID CAB14622.1 GB:DB_XREF GOA:O05412 HSSP:1B74 InterPro:IPR004391 SubtiList:BG12306 UniProtKB/Swiss-Prot:O05412 GB:GENE:GENE yrpC LENGTH 265 SQ:AASEQ MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKGKVKEYIFNAAEFLASQNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCTEERKRVLVVATNLTLKEEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYLKNELSSFDLKQYGTIVLGCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQLGKGSGSITFFNSGHKIVDQEVISKYKRLFEILDETQRSHVGH GT:EXON 1|1-265:0| SW:ID MURI2_BACSU SW:DE RecName: Full=Glutamate racemase 2; EC=5.1.1.3; SW:GN Name=yrpC; OrderedLocusNames=BSU26810; SW:KW Cell shape; Cell wall biogenesis/degradation; Complete proteome;Isomerase; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->265|MURI2_BACSU|e-152|100.0|265/265| GO:SWS:NREP 4 GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| PROS 67->75|PS00923|ASP_GLU_RACEMASE_1|PDOC00714| BL:PDB:NREP 1 BL:PDB:REP 3->248|2gzmB|5e-37|32.4|244/265| RP:PDB:NREP 1 RP:PDB:REP 3->236|2dwuA|5e-38|31.9|232/265| RP:PFM:NREP 1 RP:PFM:REP 3->197|PF01177|2e-20|39.0|182/211|Asp_Glu_race| HM:PFM:NREP 1 HM:PFM:REP 3->213|PF01177|2.7e-37|29.4|197/217|Asp_Glu_race| RP:SCP:NREP 3 RP:SCP:REP 1->100|1b73A1|8e-17|43.0|100/105|c.78.2.1| RP:SCP:REP 92->194|1iu9A|3e-14|11.1|99/111|c.78.2.1| RP:SCP:REP 177->265|2eyqA3|7e-04|35.1|77/233|c.37.1.19| HM:SCP:REP 1->104|1b74A1|1.5e-36|49.0|104/0|c.78.2.1|1/1|Aspartate/glutamate racemase| HM:SCP:REP 107->251|1b74A2|1.7e-24|31.6|136/147|c.78.2.1|1/1|Aspartate/glutamate racemase| OP:NHOMO 816 OP:NHOMOORG 778 OP:PATTERN -------------------------------------------------------------------1 1111111111111111111-1111111111111111-1--111111111111111112--1-11111---111111111111111111111111111--111111121-1--------------111111111111111-1---1-11111111111111111111111111111111-1111111111111112222222111221121111122111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111211-111131-11-1-111111111111111111111111111111112-1111111111111111111111111111-111111111111111111--11121-------------------------------11111-----1111111111111111111-111111111111111111111111111111111111111111111-1111111111-1111111111111111111121111-1111111111111111111111111-1111-1111111111111211122111-1----11-11111111111111111111-11111211111111111111111111111111111111111111111212111111111111111-111111111111111-111111111111111122222211111111111111112111111111111111-11111111111111----------------111111111111111111--------------------------11111-1----1- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 98.9 SQ:SECSTR ccEEEEEcccTTHHHHHHHHHHcTTccEEEEEcGGGcccTTccHHHHHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHTHccccEEEEEEcHHHHHTTHHHHHHHHHcTTcEEEEEEcTTHHHHHHHcTTcHHHHHHHHHHHHHHHHTccccEEEEccTTGGGGHHHHHHHHcTTcEEEEHHHHHHHHHHHHHHHTTcccccccccEEEEccccTTHHHHHHHTHTcTTc##ccEEcccc# DISOP:02AL 223-224, 262-265| PSIPRED ccEEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEcHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccc //