[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrpD
DDBJ      :yrpD         putative lipoprotein
Swiss-Prot:YRPD_BACSU   RecName: Full=Uncharacterized protein yrpD;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->141 2j1nA PDBj 1e-04 32.7 %
:HMM:PFM   138->205 PF08932 * DUF1914 0.00081 19.1 68/114  
:BLT:SWISS 1->235 YRPD_BACSU e-123 100.0 %
:REPEAT 2|44->111|117->189
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14623.1 GT:GENE yrpD GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2739486..2740193 GB:FROM 2739486 GB:TO 2740193 GB:DIRECTION + GB:GENE yrpD GB:PRODUCT putative lipoprotein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type lp: lipoprotein GB:PROTEIN_ID CAB14623.1 GB:DB_XREF SubtiList:BG12307 UniProtKB/Swiss-Prot:O05411 GB:GENE:GENE yrpD LENGTH 235 SQ:AASEQ MMKKGLLAGALTATVLFGTCAVDVPGIISPKTAEAASQLTDGIGGRAYLNSNGAILVTKIQLPSSTQVSNGTAYIYSGFSGGTESDIGFQYSDKYNVWKPYMKVGSKGQDQVQYLEGGSQFTNTKGFRPGSTVQLTIYKNLNGNTRATYWGTNNAGYNGRLISEISKTNVGSISKWKALATVATTGSRQSIKSNFSTSFTNITIDNKAITPVIDTQDFAKVTVSGNSVSLSVVKN GT:EXON 1|1-235:0| SW:ID YRPD_BACSU SW:DE RecName: Full=Uncharacterized protein yrpD; SW:GN Name=yrpD; OrderedLocusNames=BSU26820; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|YRPD_BACSU|e-123|100.0|235/235| NREPEAT 1 REPEAT 2|44->111|117->189| SEG 5->19|gllagaltatvlfgt| BL:PDB:NREP 1 BL:PDB:REP 34->141|2j1nA|1e-04|32.7|104/346| HM:PFM:NREP 1 HM:PFM:REP 138->205|PF08932|0.00081|19.1|68/114|DUF1914| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 52.8 SQ:SECSTR #################################cGGGccccEEEEEEEEEETTEEEEEEEEEEEccTTTccTTcccccEEEEEEEEEEEEEEEEEccHHHTcccTTccccEEEEEEEEEEEccTTcEEEEEEEEEEEEEccHHHHHHH#ccTTcHHHH############################################################################# DISOP:02AL 1-2| PSIPRED cccEEEEEHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccEEEEcccccEEEEEEEEccEEEccccccEEEEcccccccccccEEEcccccHHHHHHHHccccccEEEEEEcccEEccccccccccEEEEEEEEcccccEEEEEEEccccccccEEEEEEccccccccHHHHEEEEEEEccccHHEEEEccccEEEEEEcccEEccEEcccccEEEEEEccEEEEEEEcc //