[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrpG
DDBJ      :yrpG         putative oxidoreductase
Swiss-Prot:YRPG_BACSU   RecName: Full=Uncharacterized oxidoreductase yrpG;         EC=1.-.-.-;

Homologs  Archaea  41/68 : Bacteria  659/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->316 1lqaA PDBj 4e-34 32.1 %
:RPS:PDB   1->313 3eauA PDBj 2e-60 28.3 %
:RPS:SCOP  2->317 1pyfA  c.1.7.1 * 1e-65 28.4 %
:HMM:SCOP  1->321 1lqaA_ c.1.7.1 * 1.6e-91 42.6 %
:RPS:PFM   16->306 PF00248 * Aldo_ket_red 8e-43 44.5 %
:HMM:PFM   15->313 PF00248 * Aldo_ket_red 5.4e-74 37.6 282/284  
:BLT:SWISS 1->326 YRPG_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14626.2 GT:GENE yrpG GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2742909..2743889 GB:FROM 2742909 GB:TO 2743889 GB:DIRECTION + GB:GENE yrpG GB:PRODUCT putative oxidoreductase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14626.2 GB:DB_XREF GOA:O05408 HSSP:1LQA InterPro:IPR018170 SubtiList:BG12309 UniProtKB/Swiss-Prot:O05408 GB:GENE:GENE yrpG LENGTH 326 SQ:AASEQ MEYTYLGRTGLRVSRLCLGTMNFGVDTDEKTAFRIMDEALDNGIQFFDTANIYGWGKNAGLTESIIGKWFAQGGQRREKVVLATKVYEPISDPNDGPNDMRGLSLYKIRRHLEGSLKRLQTDHIELYQMHHIDRRTPWDEIWEAFETQVRSGKVDYIGSSNFAGWHLVKAQAEAEKRRFMGLVTEQHKYSLLERTAEMEVLPAARDLGLGVVAWSPLAGGLLGGKALKSNAGTRTAKRADLIEKHRLQLEKFSDLCKELGEKEANVALAWVLANPVLTAPIIGPRTVEQLRDTIKAVEISLDKEILRMLNDIFPGPGGETPEAYAW GT:EXON 1|1-326:0| SW:ID YRPG_BACSU SW:DE RecName: Full=Uncharacterized oxidoreductase yrpG; EC=1.-.-.-; SW:GN Name=yrpG; OrderedLocusNames=BSU26850; SW:KW Coiled coil; Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->326|YRPG_BACSU|0.0|100.0|326/326| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 217->228|laggllggkalk| BL:PDB:NREP 1 BL:PDB:REP 1->316|1lqaA|4e-34|32.1|315/346| RP:PDB:NREP 1 RP:PDB:REP 1->313|3eauA|2e-60|28.3|304/327| RP:PFM:NREP 1 RP:PFM:REP 16->306|PF00248|8e-43|44.5|265/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 15->313|PF00248|5.4e-74|37.6|282/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 2->317|1pyfA|1e-65|28.4|299/311|c.1.7.1| HM:SCP:REP 1->321|1lqaA_|1.6e-91|42.6|317/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 4000 OP:NHOMOORG 883 OP:PATTERN 112-2-13555544512922212-533717631----------1-----13-2-------15433-11 58I3O112234-1-14411-1-112A111111133337768E6KDC624CB2BDF318--8564H2GGFD52222132---14--11-4721-3-----1-7131G-424--------------11-1111--12212244111B-423512322111-1---211893H4------------7721133-92755555434243445342554744523534535555636M22222222222222232224227144113225433552351552211112---122222222222221-----11----1122---22221--242222222-212-------4-21-2-2-----11-31--2313---2-38442-----B77661-134212----------7-45745B457B1-KFF9EECNLEBC7425-32721234332222222259842133-----------------------------11553424436A9999B8545477BA555535C8H1424--22262422434762141-2111-----------122121--2---11----3121-23315887AI-21-1---------11-1--111--11131161341-6221112122111122111112----111------43561765556566645-54556445655685555549A766---3364645445654556733443441-644444444444----------111-13551--7-5-------1-22212231119155354436343452666211-12--11-121111112111134656553334111--12111111111-1-----1----1-------------2------2242144444384 11------1---124E996CBD8GFII3312224313212122111CAEKBGOKDB8655452-2-1322365153527635551333-PmH9BXB5468433A88-16EG7776542343944652D5MY8-B8C131152463141327219453363431942-4229-1322565V3457ADDJH9AH44TFOI8 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 100.0 SQ:SECSTR ccEEEcTTcccEEEcEEEEcTTccccccHHHHHHHHHHHHHTTccEEEEETTGGGGHHHHHHHHHHHHHHHHHTccGGGcEEEEEEccccccGGGccGGGccccHHHHHHHHHHHHHHHTcccEEEEEEccccTTccHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHHHHTTcccccEEEEEccTTccHHHHHHHHHHHHHccEEEEEcTTGGGGGGTTTTTcccTTcGGGcTTHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHccTTccEEEEccccHHHHHHHHGGGGGGccHHHHHHHHHHHHHHGGGccccccc DISOP:02AL 326-327| PSIPRED ccEEEccccccEEccEEEEcccccccccHHHHHHHHHHHHHccccEEEcHHHHcccccccHHHHHHHHHHHHccccHHHEEEEcccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccc //