[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrrM
DDBJ      :yrrM         putative acyl-CoA O-methyltransferase
Swiss-Prot:YRRM_BACSU   RecName: Full=Putative O-methyltransferase yrrM;         EC=2.1.1.-;

Homologs  Archaea  6/68 : Bacteria  340/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->216 2gpyB PDBj 5e-37 51.7 %
:RPS:PDB   6->215 2avdA PDBj 3e-19 22.5 %
:RPS:SCOP  4->173 1h1dA  c.66.1.1 * 9e-35 25.6 %
:HMM:SCOP  2->219 2cl5A1 c.66.1.1 * 4.4e-42 29.3 %
:RPS:PFM   56->210 PF01596 * Methyltransf_3 1e-27 47.0 %
:HMM:PFM   37->215 PF01596 * Methyltransf_3 5.1e-32 31.4 172/205  
:BLT:SWISS 1->217 YRRM_BACSU e-125 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14678.1 GT:GENE yrrM GT:PRODUCT putative acyl-CoA O-methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2795082..2795735) GB:FROM 2795082 GB:TO 2795735 GB:DIRECTION - GB:GENE yrrM GB:PRODUCT putative acyl-CoA O-methyltransferase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14678.1 GB:DB_XREF GOA:O32036 InterPro:IPR002935 SubtiList:BG13794 UniProtKB/Swiss-Prot:O32036 GB:GENE:GENE yrrM LENGTH 217 SQ:AASEQ MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILEIGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADAVHVTAPYDVIFIDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVAEDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQTAIIPVGDGLAISKKKR GT:EXON 1|1-217:0| SW:ID YRRM_BACSU SW:DE RecName: Full=Putative O-methyltransferase yrrM; EC=2.1.1.-; SW:GN Name=yrrM; OrderedLocusNames=BSU27360; SW:KW Complete proteome; Metal-binding; Methyltransferase;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->217|YRRM_BACSU|e-125|100.0|217/217| GO:SWS:NREP 3 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 8->216|2gpyB|5e-37|51.7|176/185| RP:PDB:NREP 1 RP:PDB:REP 6->215|2avdA|3e-19|22.5|204/219| RP:PFM:NREP 1 RP:PFM:REP 56->210|PF01596|1e-27|47.0|149/191|Methyltransf_3| HM:PFM:NREP 1 HM:PFM:REP 37->215|PF01596|5.1e-32|31.4|172/205|Methyltransf_3| GO:PFM:NREP 1 GO:PFM GO:0008171|"GO:O-methyltransferase activity"|PF01596|IPR002935| RP:SCP:NREP 1 RP:SCP:REP 4->173|1h1dA|9e-35|25.6|168/214|c.66.1.1| HM:SCP:REP 2->219|2cl5A1|4.4e-42|29.3|205/0|c.66.1.1|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 525 OP:NHOMOORG 421 OP:PATTERN ------------------------1--1--11----------------------------------11 112-----------12211-11----11111-1111-1---111---1----2-----111-1-31-1111------------1-111111111111-111111111111--------------1-----------11122---1-1121111--11------11--2132--------------------111222222332231222221121223111221111111121111111111111111111111----------------------111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111--11--1111-11-------------1----------------------------1---1-----------1---11------------11111111------1-1111111111---------------11111-----------111-1-----11--------1-----------------------------1-11111-1111---1---------------2--111--1-1111-----1------------------------1-------------------------------11---------------------------------------------111----------------------------------------------1111111111--1-2---------------2222221-----1111-------------121111212---------------------------------11--11----------1111--------1-----------------------1-- ----31---------1-----2-1------111111-------1--1-1112121112-111---------------------------111-131111----112--21-14122-------------------------------------1-11111---12------3425-22-7111-42216-82--11112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR ccccHcHHHHHHHHTTccccHHHHHHHHHHHTcGGGcccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHTTccTcEEEEEEcccHHHHHHHHHHHHTTcTTTEEEEEccHHHHHHHHHHTTcTEEEEEccccTTHHHHHHHHHHHEEEEEEEEEEcccGGGGGGcccGHHHccTTcHHHHHHHHHHHHHHHcTTEEEEEEccTTcEEEEEEcc DISOP:02AL 217-218| PSIPRED cccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccEEEEEEcc //