[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrrS
DDBJ      :yrrS         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   132->232 PF07423 * DUF1510 6e-16 51.0 %
:HMM:PFM   6->232 PF07423 * DUF1510 1.3e-85 53.9 217/217  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14672.1 GT:GENE yrrS GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2788920..2789621) GB:FROM 2788920 GB:TO 2789621 GB:DIRECTION - GB:GENE yrrS GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 14679248 GB:PROTEIN_ID CAB14672.1 GB:DB_XREF InterPro:IPR009988 SubtiList:BG13798 UniProtKB/TrEMBL:O32031 GB:GENE:GENE yrrS LENGTH 233 SQ:AASEQ MSNNQSRYENRDKRRKANLVLNILIAIVSILIVVVAANLFINSPSSKDVSKDSETAQKQESPASGKTEKKSDEDIKDSKKDTSDSEKDSEKSSDSDSKKDDSSSKKDDSDSDSSSDSAGDGLKDAKVTEGGSSSDVEKTYENPDWKAVGTEQTGEHAATYDSSSQDWAEMLKAISYATGVSTDNMTVLWLGNNGSPQDAKGKILDKATGNKYQVTITWVDEKGWKPTKVEKLK GT:EXON 1|1-233:0| TM:NTM 1 TM:REGION 20->42| SEG 17->39|anlvlniliaivsilivvvaanl| SEG 66->117|ktekksdedikdskkdtsdsekdsekssdsdskkddssskkddsdsdsssds| RP:PFM:NREP 1 RP:PFM:REP 132->232|PF07423|6e-16|51.0|100/216|DUF1510| HM:PFM:NREP 1 HM:PFM:REP 6->232|PF07423|1.3e-85|53.9|217/217|DUF1510| OP:NHOMO 41 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111211111122111111111211111--111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-16, 42-144, 150-164| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccHHHHHHcccccccccccHHHHccccccccccccccccccccccccccHHHccccccccccccHHHcccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEcc //