[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrvC
DDBJ      :yrvC         putative potassium transport accessory component
Swiss-Prot:YRVC_BACSU   RecName: Full=Uncharacterized protein yrvC;

Homologs  Archaea  4/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.286.1d.87.2
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->155 2bkoA PDBj 3e-07 14.3 %
:RPS:SCOP  48->104 1jroA3  d.87.2.1 * 8e-04 21.1 %
:RPS:SCOP  76->158 1vctA2  d.286.1.1 * 3e-10 19.5 %
:HMM:SCOP  73->159 1vctA2 d.286.1.1 * 7e-12 26.5 %
:RPS:PFM   96->157 PF02080 * TrkA_C 7e-06 31.7 %
:HMM:PFM   94->158 PF02080 * TrkA_C 2e-15 30.2 63/71  
:HMM:PFM   48->85 PF03450 * CO_deh_flav_C 0.00064 26.3 38/103  
:BLT:SWISS 1->165 YRVC_BACSU 2e-92 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14723.1 GT:GENE yrvC GT:PRODUCT putative potassium transport accessory component GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2826245..2826742) GB:FROM 2826245 GB:TO 2826742 GB:DIRECTION - GB:GENE yrvC GB:PRODUCT putative potassium transport accessory component GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 14563871; Product type pt : putative transporter GB:PROTEIN_ID CAB14723.1 GB:DB_XREF GOA:O32046 InterPro:IPR006037 SubtiList:BG13802 UniProtKB/Swiss-Prot:O32046 GB:GENE:GENE yrvC LENGTH 165 SQ:AASEQ MRVRESELPGIGQKVEMITRNRDKISIIIHHDGRRELYYFDENDHEECVASVQFDDAEARQMSAILGGMAYKPKALEQVESALDDLIIEWCKAEAGAPAIHQTIGDLNVGQEYHVTVIAIVKKNQDKQLNPSSETVIDEGDTLVISGEGTGLKRLIREKLTAKGA GT:EXON 1|1-165:0| SW:ID YRVC_BACSU SW:DE RecName: Full=Uncharacterized protein yrvC; SW:GN Name=yrvC; OrderedLocusNames=BSU27640; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|YRVC_BACSU|2e-92|100.0|165/165| RP:PDB:NREP 1 RP:PDB:REP 24->155|2bkoA|3e-07|14.3|126/190| RP:PFM:NREP 1 RP:PFM:REP 96->157|PF02080|7e-06|31.7|60/71|TrkA_C| HM:PFM:NREP 2 HM:PFM:REP 94->158|PF02080|2e-15|30.2|63/71|TrkA_C| HM:PFM:REP 48->85|PF03450|0.00064|26.3|38/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 48->104|1jroA3|8e-04|21.1|57/117|d.87.2.1| RP:SCP:REP 76->158|1vctA2|3e-10|19.5|82/94|d.286.1.1| HM:SCP:REP 73->159|1vctA2|7e-12|26.5|83/0|d.286.1.1|1/1|TrkA C-terminal domain-like| OP:NHOMO 75 OP:NHOMOORG 54 OP:PATTERN ------------------------1--1--2------------1------------------------ ---------------------------------111-1----121-------11------11---------------------1-111-----------------------------------------------------------------------------------------------11111-----222222222-222222-----22221-1--1-------11---------------------------------------------------------------------------------------------------------1------------1---1--11-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 90.9 SQ:SECSTR ##############HHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcccEEEEEEccTTcTTTTccHHHHTHHHHHccEEEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHHHHHHHHHHHHTT# DISOP:02AL 163-165| PSIPRED cccEEEEccccEEEEEEEEccccEEEEEEEccccEEEEEEcccccccccEEEEEcHHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEEEccccccccccHHHHccHHcccEEEEEEEEcccEEEEcccccEEEccccEEEEEEcHHHHHHHHHHHHHHccc //