[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrvD
DDBJ      :yrvD         conserved hypothetical protein
Swiss-Prot:YRVD_BACSU   RecName: Full=Uncharacterized protein yrvD;

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->77 PF06305 * DUF1049 4e-07 35.8 %
:HMM:PFM   11->84 PF06305 * DUF1049 6.8e-20 28.4 74/80  
:BLT:SWISS 1->107 YRVD_BACSU 2e-56 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14722.1 GT:GENE yrvD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2825846..2826169) GB:FROM 2825846 GB:TO 2826169 GB:DIRECTION - GB:GENE yrvD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14722.1 GB:DB_XREF GOA:O32045 SubtiList:BG13803 UniProtKB/Swiss-Prot:O32045 GB:GENE:GENE yrvD LENGTH 107 SQ:AASEQ MNKQWTIIFALIFTLIVAIFAVINVRSVEVDYLFGRSEWPLILVILGSVLMGALIVFSVGIFQVMKLKREIKTLRKENRTAIHKQEDTHLADQTDTQDASAMIEKKD GT:EXON 1|1-107:0| SW:ID YRVD_BACSU SW:DE RecName: Full=Uncharacterized protein yrvD; SW:GN Name=yrvD; OrderedLocusNames=BSU27630; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|YRVD_BACSU|2e-56|100.0|107/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 5->27| TM:REGION 42->64| RP:PFM:NREP 1 RP:PFM:REP 11->77|PF06305|4e-07|35.8|67/81|DUF1049| HM:PFM:NREP 1 HM:PFM:REP 11->84|PF06305|6.8e-20|28.4|74/80|DUF1049| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------11111-----------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 105-107| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccccccccccccHHHHHHcccc //