[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrzA
DDBJ      :yrzA         conserved hypothetical protein
Swiss-Prot:YRZA_BACSU   RecName: Full=Uncharacterized protein yrzA;

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:RPS:PFM   1->63 PF10750 * DUF2536 1e-13 65.1 %
:HMM:PFM   1->66 PF10750 * DUF2536 1.1e-39 77.3 66/68  
:BLT:SWISS 1->67 YRZA_BACSU 7e-33 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14671.1 GT:GENE yrzA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2788680..2788883 GB:FROM 2788680 GB:TO 2788883 GB:DIRECTION + GB:GENE yrzA GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14671.1 GB:DB_XREF InterPro:IPR019686 SubtiList:BG13811 UniProtKB/Swiss-Prot:O32030 GB:GENE:GENE yrzA LENGTH 67 SQ:AASEQ MNFQLDLIKDKVEFFEAASLQELEKKINTQIENNKAIMLRVKSVSHQTLVAEGRILYSAVVHFSAEA GT:EXON 1|1-67:0| SW:ID YRZA_BACSU SW:DE RecName: Full=Uncharacterized protein yrzA; SW:GN Name=yrzA; OrderedLocusNames=BSU27290; SW:KW Coiled coil; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->67|YRZA_BACSU|7e-33|100.0|67/67| RP:PFM:NREP 1 RP:PFM:REP 1->63|PF10750|1e-13|65.1|63/68|DUF2536| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF10750|1.1e-39|77.3|66/68|DUF2536| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11111111111-11111111111-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccEEEEEEEEEEEcc //