[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrzE
DDBJ      :yrzE         putative integral inner membrane protein
Swiss-Prot:YRZE_BACSU   RecName: Full=Uncharacterized membrane protein yrzE;

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->112 PF01988 * VIT1 8.3e-06 21.7 92/213  
:BLT:SWISS 1->150 YRZE_BACSU 1e-55 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14729.1 GT:GENE yrzE GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2831915..2832367 GB:FROM 2831915 GB:TO 2832367 GB:DIRECTION + GB:GENE yrzE GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB14729.1 GB:DB_XREF SubtiList:BG13815 UniProtKB/Swiss-Prot:O32051 GB:GENE:GENE yrzE LENGTH 150 SQ:AASEQ MSDGFEQKEQKPFNTGREETIMEETKQVGKGILYGLIAIFSAMLLTSLAVSLLLTATSLEESSFNWLITAISFLSLFIGGFISGGKGKERGWMIGALTALSFSLIILLFQYLGFGKTFTAEQLIFHLGFLGVCMLGGIFGVNMRGNRSST GT:EXON 1|1-150:0| SW:ID YRZE_BACSU SW:DE RecName: Full=Uncharacterized membrane protein yrzE; SW:GN Name=yrzE; OrderedLocusNames=BSU27690; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->150|YRZE_BACSU|1e-55|100.0|150/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 33->55| TM:REGION 64->85| TM:REGION 93->115| TM:REGION 121->142| SEG 41->63|samlltslavsllltatsleess| SEG 71->88|isflslfiggfisggkgk| HM:PFM:NREP 1 HM:PFM:REP 17->112|PF01988|8.3e-06|21.7|92/213|VIT1| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-11-111111-11-1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21, 146-150| PSIPRED ccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHEEccccccccc //