[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yrzK
DDBJ      :yrzK         hypothetical protein
Swiss-Prot:YRZK_BACSU   RecName: Full=Uncharacterized protein yrzK;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->56 YRZK_BACSU 2e-30 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14716.1 GT:GENE yrzK GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2818191..2818361) GB:FROM 2818191 GB:TO 2818361 GB:DIRECTION - GB:GENE yrzK GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14716.1 GB:DB_XREF SubtiList:BG13820 UniProtKB/Swiss-Prot:O32040 GB:GENE:GENE yrzK LENGTH 56 SQ:AASEQ MKYHPKMGRAFHDGEANLHYSDHADPDTTGYLTETASEFGLMSKEAALRKNNRNKA GT:EXON 1|1-56:0| SW:ID YRZK_BACSU SW:DE RecName: Full=Uncharacterized protein yrzK; SW:GN Name=yrzK; OrderedLocusNames=BSU27570; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->56|YRZK_BACSU|2e-30|100.0|56/100| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 45-56| PSIPRED ccccccHHHHHHcccccccccccccccccccHHHHHHHHccccHHHHHHHcccccc //