[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ysnA
DDBJ      :ysnA         inosine/xanthosine triphosphate pyrophosphatase (subunit A)
Swiss-Prot:NTPA_BACSU   RecName: Full=Nucleoside-triphosphatase;         EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase;         Short=NTPase;

Homologs  Archaea  63/68 : Bacteria  837/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->192 2pyuA PDBj 2e-37 43.6 %
:RPS:PDB   8->198 2dvoA PDBj 2e-37 34.6 %
:RPS:SCOP  5->197 1k7kA  c.51.4.1 * 2e-54 43.2 %
:HMM:SCOP  1->199 1k7kA_ c.51.4.1 * 1.9e-68 52.5 %
:RPS:PFM   8->196 PF01725 * Ham1p_like 2e-44 50.8 %
:HMM:PFM   8->195 PF01725 * Ham1p_like 3.3e-75 59.1 186/189  
:BLT:SWISS 1->198 NTPA_BACSU 2e-98 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14796.1 GT:GENE ysnA GT:PRODUCT inosine/xanthosine triphosphate pyrophosphatase (subunit A) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2900545..2901141) GB:FROM 2900545 GB:TO 2901141 GB:DIRECTION - GB:GENE ysnA GB:PRODUCT inosine/xanthosine triphosphate pyrophosphatase (subunit A) GB:FUNCTION 16.6: Maintain 16.8: Protect GB:NOTE Evidence 2b: Function of strongly homologous gene; Product type e: enzyme GB:PROTEIN_ID CAB14796.1 GB:DB_XREF GOA:P94558 HSSP:1B78 InterPro:IPR002637 SubtiList:BG12333 UniProtKB/Swiss-Prot:P94558 GB:GENE:GENE ysnA LENGTH 198 SQ:AASEQ MIIMKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEAVAKAVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQANIEKVLSELKGIEKEQRTARFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKNKISHRADALKKLSKLLEA GT:EXON 1|1-198:0| SW:ID NTPA_BACSU SW:DE RecName: Full=Nucleoside-triphosphatase; EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase; Short=NTPase; SW:GN Name=ysnA; OrderedLocusNames=BSU28360; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|NTPA_BACSU|2e-98|100.0|198/198| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 36->52|eigfteeieetghtfee| BL:PDB:NREP 1 BL:PDB:REP 4->192|2pyuA|2e-37|43.6|188/208| RP:PDB:NREP 1 RP:PDB:REP 8->198|2dvoA|2e-37|34.6|179/185| RP:PFM:NREP 1 RP:PFM:REP 8->196|PF01725|2e-44|50.8|187/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 8->195|PF01725|3.3e-75|59.1|186/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 5->197|1k7kA|2e-54|43.2|192/207|c.51.4.1| HM:SCP:REP 1->199|1k7kA_|1.9e-68|52.5|198/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 1079 OP:NHOMOORG 1021 OP:PATTERN 111111111111111111111111-11111--11111111111-111111111111111111111-11 1111111111111111111-111111111111111111111122111111111111111111111111111-1111111111-1111111111111---1111111111111111111111111111111111111111111111111111111111222222111111112222222222221111111111111111111111111112111111111111111111111111111111111111111111211111121212222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-1111111-----------------------------111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-1-------1111111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111211111111111121111111111111111111111111111111111111111111111111----1---1--------11------1111111111111 1---1---111-111-----111-111-------11-111111-11--12--1--11-11111--1------11-------1111111-121-11111111111----3-1-22112--1--1-11-2-352-213-1--11111-11--1-11-111111111--1111611-111-----1-11111-111221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 100.0 SQ:SECSTR HHTTcEEEEEcccHHHHHHHHHHHGGGTcEEEEEEccccccccccccccHHHHHHHHHHHHTTTccccEEEEEEEEEEGGGTTTcGGGHHHHHHHTccHHTHHHHHHHHHTTccccccEEEEEEEEEEEETTEEEEEEEEEEEEEEccccccccccTTGGGEEETTccccGGGccHHHHHHHcHHHHHHHHHHHHHHH DISOP:02AL 1-2| PSIPRED ccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHccEEEEEccEEEEEccccccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccccccEEEEEccccccHHcccHHHHHcccHHHHHHHHHHHHHcc //