[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytcD
DDBJ      :ytcD         putative transcriptional regulator (MarD family)
Swiss-Prot:YTCD_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator ytcD;

Homologs  Archaea  19/68 : Bacteria  452/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->104 2hztA PDBj 9e-42 95.5 %
:RPS:PDB   10->87 2d1hB PDBj 3e-09 14.3 %
:RPS:SCOP  9->104 1z7uA1  a.4.5.69 * 3e-35 41.7 %
:HMM:SCOP  1->102 2fswA1 a.4.5.69 * 1.2e-32 44.1 %
:RPS:PFM   17->102 PF01638 * HxlR 8e-28 61.6 %
:HMM:PFM   16->104 PF01638 * HxlR 9.9e-43 60.7 89/91  
:BLT:SWISS 1->126 YTCD_BACSU 6e-71 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14863.1 GT:GENE ytcD GT:PRODUCT putative transcriptional regulator (MarD family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2968260..2968640) GB:FROM 2968260 GB:TO 2968640 GB:DIRECTION - GB:GENE ytcD GB:PRODUCT putative transcriptional regulator (MarD family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB14863.1 GB:DB_XREF GOA:O34533 InterPro:IPR002577 PDB:2HZT SubtiList:BG13831 UniProtKB/Swiss-Prot:O34533 GB:GENE:GENE ytcD LENGTH 126 SQ:AASEQ MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINRVYGDTFSVLEESVLNDKLKQES GT:EXON 1|1-126:0| SW:ID YTCD_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator ytcD; SW:GN Name=ytcD; OrderedLocusNames=BSU29030; SW:KW 3D-structure; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->126|YTCD_BACSU|6e-71|100.0|126/126| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 10->104|2hztA|9e-42|95.5|89/91| RP:PDB:NREP 1 RP:PDB:REP 10->87|2d1hB|3e-09|14.3|77/96| RP:PFM:NREP 1 RP:PFM:REP 17->102|PF01638|8e-28|61.6|86/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 16->104|PF01638|9.9e-43|60.7|89/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 9->104|1z7uA1|3e-35|41.7|96/108|a.4.5.69| HM:SCP:REP 1->102|2fswA1|1.2e-32|44.1|102/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1156 OP:NHOMOORG 476 OP:PATTERN 11-------------1--------211211----1----1---481-1-2211--------------- 2---9--2111---1------2--14-----111115233-A4A23-1----321--2--21--4-6965------11--231-1-1-1211-12----1-A---c5B-2----------------------------------114-1222---111-----11-11211-------------------121799999A5936B978A468888819--15364322222AI1------1--11---2---22-4-22--1--542222322-2-232---1-----1------------1111-1111111-11---11111--8H2223222141-7111-2131----1---341------1---2-321-1-33------43444--13222-----------3-23142426171-9654641566234251--321--1-1211111111-323---2-----------------------------2-2112-1111345272122222231222222322-122----41-1--1--11--2--11-2----------1-1-111-1111-31111-11---11111---21-13-11-2121-1-1--------2---221-12--1-----11-1-1-------------------------2136-3-1111111111-111111111111111111122163--11111--1---11111111111111--211111111111---------1111-1522---211-----1--144344-1----1----2113--------1-------------1-----1----32131321111111---2----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3--------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 85.7 SQ:SECSTR ccccEEEEcHHHHHHTccHHHHHHHHHHHHTccccHHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHTTccH################## DISOP:02AL 1-5, 124-126| PSIPRED cccccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccc //