[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytkD
DDBJ      :ytkD         nucleoside triphosphate phosphohydrolase
Swiss-Prot:YTKD_BACSU   RecName: Full=Putative 7,8-dihydro-8-oxoguanine-triphosphatase ytkD;         EC=3.6.1.-;AltName: Full=8-oxo-dGTPase;AltName: Full=dGTP pyrophosphohydrolase;

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->114 1sjyA PDBj 8e-08 42.2 %
:RPS:PDB   30->102 3dkuF PDBj 3e-13 28.8 %
:RPS:SCOP  28->126 1vk6A2  d.113.1.4 * 1e-13 26.8 %
:HMM:SCOP  25->86 1q33A_ d.113.1.1 * 6.9e-17 51.6 %
:RPS:PFM   34->87 PF00293 * NUDIX 1e-08 54.5 %
:HMM:PFM   28->86 PF00293 * NUDIX 4.5e-15 45.8 59/135  
:BLT:SWISS 1->158 YTKD_BACSU 3e-92 100.0 %
:PROS 53->74|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15041.1 GT:GENE ytkD GT:PRODUCT nucleoside triphosphate phosphohydrolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3134983..3135459) GB:FROM 3134983 GB:TO 3135459 GB:DIRECTION - GB:GENE ytkD GB:PRODUCT nucleoside triphosphate phosphohydrolase GB:FUNCTION 16.8: Protect 16.6: Maintain 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15576788, 16513759; Product type e: enzyme GB:PROTEIN_ID CAB15041.1 GB:DB_XREF GOA:O35013 InterPro:IPR014078 SubtiList:BG13869 UniProtKB/Swiss-Prot:O35013 GB:GENE:GENE ytkD LENGTH 158 SQ:AASEQ MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEFPGGKVEPMECAEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIYFADIEKLEKQADYFETKGPVLFHELPENLSRNKKFSFIMKDSVLPISLKKLKESGWIE GT:EXON 1|1-158:0| SW:ID YTKD_BACSU SW:DE RecName: Full=Putative 7,8-dihydro-8-oxoguanine-triphosphatase ytkD; EC=3.6.1.-;AltName: Full=8-oxo-dGTPase;AltName: Full=dGTP pyrophosphohydrolase; SW:GN Name=ytkD; Synonyms=mutTA; OrderedLocusNames=BSU30630; SW:KW Complete proteome; Hydrolase; Magnesium; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|YTKD_BACSU|3e-92|100.0|158/158| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 53->74|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 23->114|1sjyA|8e-08|42.2|90/154| RP:PDB:NREP 1 RP:PDB:REP 30->102|3dkuF|3e-13|28.8|73/149| RP:PFM:NREP 1 RP:PFM:REP 34->87|PF00293|1e-08|54.5|44/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 28->86|PF00293|4.5e-15|45.8|59/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 28->126|1vk6A2|1e-13|26.8|97/131|d.113.1.4| HM:SCP:REP 25->86|1q33A_|6.9e-17|51.6|62/0|d.113.1.1|1/1|Nudix| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111-11111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 96.2 SQ:SECSTR #EEcTHHHHHHHHHHHHHHccEEEEEEEEEEEEETTEEEEEEEEcccEEccEEEccTTccHHHHHHHHHHHHHcccccccEEEEEEEEEcTTccEEEEEEEEcccccEEEEEEEEEccccEEEEEETTEEEEEHHHHTTcHHHHHHHHTTHHH##### DISOP:02AL 158-159| PSIPRED ccEEEEccccEEEEEEEcccccccccEEEEEEEEccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccccccccEEEHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccc //