[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytlC
DDBJ      :ytlC         putative ABC transporter component, ATP-binding
Swiss-Prot:YTLC_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein ytlC;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1d.41.3
:260 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->229 3fvqB PDBj 2e-32 33.3 %
:RPS:PDB   6->223 3dmdC PDBj 5e-40 12.7 %
:RPS:PDB   212->260 3cp9A PDBj 3e-04 16.3 %
:RPS:SCOP  2->198 1sgwA  c.37.1.12 * 1e-41 23.8 %
:RPS:SCOP  173->246 1uouA3  d.41.3.1 * 1e-04 14.5 %
:HMM:SCOP  3->235 1g6hA_ c.37.1.12 * 2.1e-55 36.4 %
:RPS:PFM   47->163 PF00005 * ABC_tran 5e-22 44.4 %
:HMM:PFM   47->162 PF00005 * ABC_tran 1.4e-24 36.4 110/118  
:HMM:PFM   17->56 PF03193 * DUF258 2.6e-05 15.4 39/161  
:BLT:SWISS 1->260 YTLC_BACSU e-149 100.0 %
:PROS 135->149|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15039.1 GT:GENE ytlC GT:PRODUCT putative ABC transporter component, ATP-binding GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3133387..3134169 GB:FROM 3133387 GB:TO 3134169 GB:DIRECTION + GB:GENE ytlC GB:PRODUCT putative ABC transporter component, ATP-binding GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pt: putative transporter GB:PROTEIN_ID CAB15039.1 GB:DB_XREF GOA:O34314 InterPro:IPR003593 SubtiList:BG13875 UniProtKB/Swiss-Prot:O34314 GB:GENE:GENE ytlC LENGTH 260 SQ:AASEQ MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPSEGRVLIEGREPNQKEHNIGYMLQQDYLFPWKSIEENVLLGLKIADTLTEESKAAALGLLPEFGLIDVEKKYPKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENLVFRTLKEYQKTAVLVTHDIGEAIAMSDTIFLFSNQPGTIHQIFTIPKELAAMLPFDARQEPSFQTLFQTIWKELNSLEKQQRNH GT:EXON 1|1-260:0| SW:ID YTLC_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein ytlC; EC=3.6.3.-; SW:GN Name=ytlC; OrderedLocusNames=BSU30610; SW:KW ATP-binding; Complete proteome; Hydrolase; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->260|YTLC_BACSU|e-149|100.0|260/260| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 4->229|3fvqB|2e-32|33.3|222/350| RP:PDB:NREP 2 RP:PDB:REP 6->223|3dmdC|5e-40|12.7|204/318| RP:PDB:REP 212->260|3cp9A|3e-04|16.3|49/288| RP:PFM:NREP 1 RP:PFM:REP 47->163|PF00005|5e-22|44.4|117/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 47->162|PF00005|1.4e-24|36.4|110/118|ABC_tran| HM:PFM:REP 17->56|PF03193|2.6e-05|15.4|39/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 2->198|1sgwA|1e-41|23.8|189/200|c.37.1.12| RP:SCP:REP 173->246|1uouA3|1e-04|14.5|69/99|d.41.3.1| HM:SCP:REP 3->235|1g6hA_|2.1e-55|36.4|228/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52609 OP:NHOMOORG 1175 OP:PATTERN VVLBTKLMXWXTXSePmKSUPRPbvORkkYiWKFEDECIHIGDVZUWkMR**i9UeTYZNUMHGZ1BB VexQ*fhhnnpaeVaVWQQ-QmCCa*QQQQQRwrst****V*a*u**fvkfS***TSjEF***g*uz***idbaa*cbfR*jkDCD9CVUVP5OFHK-1IHUOMOgTaPUAAAAAAAEDCCCCCLWUNVaPPZUbUmvv**LLK*Xwsv*llshmVXSMSMSLkkdo***gLXKQLNLXLPILkYgTQ*nCch*************************kt***ot***vwx**emnnnnjkklmmmkkbidfj*ocj**iTidqyxST**gXReornmnttwyvq***zwyvwtsx*tyvfffedfgikhgfe*rokhjsqtoq***********n*ox***iool*vl***otUN**vobeisTbnfqtQfccOiZWWNNONLQiZ***bVt****************-wz*so*q***TG**************MMP**********VUVVVVVVvejNTmc*66577888666789DE98BB8A88B97B6LGDFEH************************p********AOzypzkwsx******ernSYLTpaLLKJLKKVSSaikj**UketiakwecpMiceWYciXdaYXdt*Z*LLLSHOONOMICECDDDDCCJVGHLQPyvyTyUfNUO*TXbcYNXhYVVVTXdZXZa6-DMVUP32-444****c**********z*-*************wy*yxx*****munnrnnoooooomnonnm*sotxxwwT5************44KJGJGGHQSSRQL*t*ddabeZMRTPOURUjQTVUTKVJRVsZ*yyz****u****m***EEECDGFDEMnvs*tuuuu*****RRSOOPOPRSDDDDAAMXWVOOMN9A999899*BgFDCDH-EBFCJIDQQMCGQEHFAABZn*ZWt*uorEgP 3378ldM1kOAESgPHEIEFNTLWIVPLLCHEHTQOINHIHGHECEKJLPQMYWIJNDGHJIEAB9B949C7DECAC29BA969A858-IK9EDBE9AACD7GQNL9SilodpbullKJFFJbO*wA*F**v4za*QOGBlHN*cBSGHBgFD*JYXWqOw*U*UhG*dk*cegVJNHN*GJDPQ*ox*I**INtinkW ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 251-260| PSIPRED ccEEEEEEEEEEEccccccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHcccHHcccHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHcEEEEEccccccHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHcc //