[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytoA
DDBJ      :ytoA         conserved hypothetical protein
Swiss-Prot:YTOA_BACSU   RecName: Full=Uncharacterized transferase ytoA;         EC=2.-.-.-;

Homologs  Archaea  45/68 : Bacteria  605/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->170 2eg0B PDBj 1e-58 72.9 %
:RPS:PDB   1->170 2eg0A PDBj 1e-29 70.0 %
:RPS:SCOP  2->169 1xhdA  b.81.1.5 * 3e-27 66.1 %
:HMM:SCOP  1->169 1xhdA_ b.81.1.5 * 2.5e-43 39.1 %
:HMM:PFM   16->32 PF00132 * Hexapep 0.00022 47.1 17/18  
:HMM:PFM   93->110 PF00132 * Hexapep 0.00025 33.3 18/18  
:BLT:SWISS 1->171 YTOA_BACSU 1e-88 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15030.1 GT:GENE ytoA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3123490..3124005 GB:FROM 3123490 GB:TO 3124005 GB:DIRECTION + GB:GENE ytoA GB:PRODUCT conserved hypothetical protein GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15030.1 GB:DB_XREF GOA:O34696 HSSP:1KRU InterPro:IPR018357 SubtiList:BG13896 UniProtKB/Swiss-Prot:O34696 GB:GENE:GENE ytoA LENGTH 171 SQ:AASEQ MIYPYKEHKPDIHPTAFIADNATITGDVVIGEQSSIWFSVVIRGDVAPTRIGNRVNIQDLSCLHQSPNKTLLIEDDATIGHQVTLHSAVIRKNALIGMGSIILDGAEIGEGAFIGAGSLVPPGKIIPPGHLAFGRPAKVIRPLTEEDRKDMQRIRSEYVEKGQYYKFLQQT GT:EXON 1|1-171:0| SW:ID YTOA_BACSU SW:DE RecName: Full=Uncharacterized transferase ytoA; EC=2.-.-.-; SW:GN Name=ytoA; OrderedLocusNames=BSU30520; SW:KW Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->171|YTOA_BACSU|1e-88|100.0|171/171| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 105->117|gaeigegafigag| BL:PDB:NREP 1 BL:PDB:REP 1->170|2eg0B|1e-58|72.9|170/171| RP:PDB:NREP 1 RP:PDB:REP 1->170|2eg0A|1e-29|70.0|170/170| HM:PFM:NREP 2 HM:PFM:REP 16->32|PF00132|0.00022|47.1|17/18|Hexapep| HM:PFM:REP 93->110|PF00132|0.00025|33.3|18/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 2->169|1xhdA|3e-27|66.1|168/172|b.81.1.5| HM:SCP:REP 1->169|1xhdA_|2.5e-43|39.1|169/0|b.81.1.5|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 929 OP:NHOMOORG 677 OP:PATTERN ------1111111111-1------1--1---1111-1111111111111111111111111122---- 11-1111111111111111-11--11111111-1111222-112-11--111111111----2-1211111---------2121111111111111---1111-111111---------------11111111111---11---111111111111111111111111111------------111--111-111111111111111111211111111221121------1-1-------------------1---------------------------------------------------------------------1111111111111111111-111-1-----11-11-11--11-11111--2-11111-----111111111111111111111111-11211312112-111111111111111111111122111--------111-12111111111111--1-11-11-11--1111111121-111112112122111111231111112121311111213321111212111211-1111111111---32212121----------1111111--111111211---111111----------11111--111221212121111111211111122122----111------21111113222322233-2333222323222223223222111122122112111222222211222221-1-1111111111---1-11-1111112222---------------3333322111112222332224334222211111111111111111111111111111111111111--1-222222--------------------------------------1--------11 ----22--1---------------------------------------------------------------------------------------------------42-----------------------------------------------------1---------1-1331Y---335377-524332223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 100.0 SQ:SECSTR cEEccTTcccEEcTTcEEcTTcEEEEEEEEcTTcEEcTTcEEEEEEEEEEEccccEEcTTcEEEccTTccEEEcTTcEEccccEEEccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEEETTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcc DISOP:02AL 169-171| PSIPRED cccccccccEEEccccEEccccEEcccEEEccccEEccccEEEccccEEEEccccEEcccEEEEccccccEEEccccEEccccEEcccEEccccEEccccEEcccEEEccccEEEcccEEcccEEEccccEEEccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //