[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytxG
DDBJ      :ytxG         conserved hypothetical protein
Swiss-Prot:YTXG_BACSU   RecName: Full=UPF0478 protein ytxG;

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->96 PF06103 * DUF948 3e-06 38.3 %
:HMM:PFM   7->96 PF06103 * DUF948 6.5e-35 53.3 90/90  
:HMM:PFM   60->135 PF10824 * DUF2580 0.00069 19.7 76/100  
:BLT:SWISS 1->140 YTXG_BACSU 5e-57 100.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14956.2 GT:GENE ytxG GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3047593..3048015) GB:FROM 3047593 GB:TO 3048015 GB:DIRECTION - GB:GENE ytxG GB:PRODUCT conserved hypothetical protein GB:FUNCTION 16.8: Protect 16.6: Maintain GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 8733232 GB:PROTEIN_ID CAB14956.2 GB:DB_XREF GOA:P40779 InterPro:IPR009293 SubtiList:BG10974 UniProtKB/Swiss-Prot:P40779 GB:GENE:GENE ytxG LENGTH 140 SQ:AASEQ MIIILYLSVALIAVAFLVLVIYLSKTLKSLQLTLKNVASTLEGLEGQMKGITTETAELLHKTNRLAEDIQEKSEKLNTVVHAVQGVGASVQQFNTSMKQAAGSVSASVRENQDKINQVVTWSQAAMEIWEKWKQKKKSAL GT:EXON 1|1-140:0| SW:ID YTXG_BACSU SW:DE RecName: Full=UPF0478 protein ytxG; SW:GN Name=ytxG; OrderedLocusNames=BSU29780; SW:KW Coiled coil; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|YTXG_BACSU|5e-57|100.0|140/140| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 20->59| TM:NTM 1 TM:REGION 3->25| SEG 7->20|lsvaliavaflvlv| SEG 23->35|lsktlkslqltlk| RP:PFM:NREP 1 RP:PFM:REP 37->96|PF06103|3e-06|38.3|60/90|DUF948| HM:PFM:NREP 2 HM:PFM:REP 7->96|PF06103|6.5e-35|53.3|90/90|DUF948| HM:PFM:REP 60->135|PF10824|0.00069|19.7|76/100|DUF2580| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111-11111111111--11111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-18| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccc //