[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ytzC
DDBJ      :ytzC         conserved hypothetical protein
Swiss-Prot:YTZC_BACSU   RecName: Full=Uncharacterized protein ytzC;

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->84 PF10732 * DUF2524 2e-10 64.3 %
:HMM:PFM   1->84 PF10732 * DUF2524 5.3e-43 66.7 84/84  
:BLT:SWISS 1->90 YTZC_BACSU 6e-49 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15025.1 GT:GENE ytzC GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3119565..3119837) GB:FROM 3119565 GB:TO 3119837 GB:DIRECTION - GB:GENE ytzC GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15025.1 GB:DB_XREF InterPro:IPR019668 SubtiList:BG13937 UniProtKB/Swiss-Prot:O32073 GB:GENE:GENE ytzC LENGTH 90 SQ:AASEQ MATRQSVDEHLQQCMQAYDYAEEQLKIASKQEHYNDQEYSDAQMQLEDAVNALNKLWLSSNDQQREQLYRMRLQLQSLQNNMILQHPLDV GT:EXON 1|1-90:0| SW:ID YTZC_BACSU SW:DE RecName: Full=Uncharacterized protein ytzC; SW:GN Name=ytzC; OrderedLocusNames=BSU30470; SW:KW Coiled coil; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->90|YTZC_BACSU|6e-49|100.0|90/90| COIL:NAA 15 COIL:NSEG 1 COIL:REGION 35->49| RP:PFM:NREP 1 RP:PFM:REP 1->84|PF10732|2e-10|64.3|84/84|DUF2524| HM:PFM:NREP 1 HM:PFM:REP 1->84|PF10732|5.3e-43|66.7|84/84|DUF2524| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111--1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccc //