[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yubF
DDBJ      :yubF         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->65 PF05360 * YiaAB 1e-06 41.5 %
:HMM:PFM   12->65 PF05360 * YiaAB 3.3e-23 49.1 53/53  
:BLT:SWISS 11->68 YIAA_SHIFL 7e-09 40.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15089.1 GT:GENE yubF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3190462..3190725) GB:FROM 3190462 GB:TO 3190725 GB:DIRECTION - GB:GENE yubF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15089.1 GB:DB_XREF InterPro:IPR008024 SubtiList:BG13955 UniProtKB/TrEMBL:O32082 GB:GENE:GENE yubF LENGTH 87 SQ:AASEQ MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQKVTRDNAEDNEIIAEQEKRQNQSHIES GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 11->68|YIAA_SHIFL|7e-09|40.4|57/145| TM:NTM 2 TM:REGION 11->33| TM:REGION 42->64| RP:PFM:NREP 1 RP:PFM:REP 12->65|PF05360|1e-06|41.5|53/53|YiaAB| HM:PFM:NREP 1 HM:PFM:REP 12->65|PF05360|3.3e-23|49.1|53/53|YiaAB| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 75-87| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc //