[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yufN
DDBJ      :yufN         putative lipoprotein
Swiss-Prot:YUFN_BACSU   RecName: Full=Uncharacterized lipoprotein yufN;Flags: Precursor;

Homologs  Archaea  26/68 : Bacteria  290/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->341 2fqwA PDBj 9e-61 43.7 %
:RPS:PDB   41->266 3dbiC PDBj 1e-15 14.2 %
:RPS:SCOP  52->266 1bdhA2  c.93.1.1 * 9e-08 12.0 %
:HMM:SCOP  38->302 1tlfA_ c.93.1.1 * 2.3e-10 16.9 %
:RPS:PFM   42->337 PF02608 * Bmp 2e-43 49.1 %
:HMM:PFM   40->350 PF02608 * Bmp 4.4e-104 44.3 298/306  
:BLT:SWISS 1->359 YUFN_BACSU e-176 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15143.2 GT:GENE yufN GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3239930..3241009 GB:FROM 3239930 GB:TO 3241009 GB:DIRECTION + GB:GENE yufN GB:PRODUCT putative lipoprotein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type lp: lipoprotein GB:PROTEIN_ID CAB15143.2 GB:DB_XREF GOA:O05252 InterPro:IPR003760 SubtiList:BG12349 UniProtKB/Swiss-Prot:O05252 GB:GENE:GENE yufN LENGTH 359 SQ:AASEQ MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAWEGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIADQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKKFEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFTEAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGKFPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE GT:EXON 1|1-359:0| SW:ID YUFN_BACSU SW:DE RecName: Full=Uncharacterized lipoprotein yufN;Flags: Precursor; SW:GN Name=yufN; OrderedLocusNames=BSU31540; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->359|YUFN_BACSU|e-176|100.0|359/359| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| SEG 24->38|gnsekssgsgegknk| SEG 67->78|gkenglkkgkng| SEG 282->295|vkkvdtvvedvtkk| BL:PDB:NREP 1 BL:PDB:REP 39->341|2fqwA|9e-61|43.7|295/316| RP:PDB:NREP 1 RP:PDB:REP 41->266|3dbiC|1e-15|14.2|211/268| RP:PFM:NREP 1 RP:PFM:REP 42->337|PF02608|2e-43|49.1|275/288|Bmp| HM:PFM:NREP 1 HM:PFM:REP 40->350|PF02608|4.4e-104|44.3|298/306|Bmp| GO:PFM:NREP 1 GO:PFM GO:0008289|"GO:lipid binding"|PF02608|IPR003760| RP:SCP:NREP 1 RP:SCP:REP 52->266|1bdhA2|9e-08|12.0|209/282|c.93.1.1| HM:SCP:REP 38->302|1tlfA_|2.3e-10|16.9|249/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 447 OP:NHOMOORG 317 OP:PATTERN 111-11------------11111122211-1-------------1---------1111111---1--- ----1---------------------------------------211-122111111---1121111321--------1---1------------------------------------------1111111111111111---1--1-------------------1111------------3212211-1321111111111111111-1122111211223211111133--------------------22-3--3-111---------2211112223111111111111111112222222222222111111111211212111111111222--1222311111----11-1--111111111-12------------------------111-1-11111-------1-11--2112111112331----1112222111---------11---13-----------------------------------1-----------------2----------1211--1111----11-----2-----2------------1-1-2---1-1-3--1--------------11-1---------------------------1-1-1-----1-------1------2--1----------------------------------------------------------------------------------------------------------------1-1-----------------------------------------111-----------------------------------------4------64445444211-------------------------1342214111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 84.1 SQ:SECSTR ######################################cEEEEEEcTTTTccccHHHHHHHHHHHHHHTTccEHHHTTcEEEEEEcTTcHHHHHHHHHHTTccEEEccccccHHHHHHHHHHccccEEEEEcccccccGGGEEcccHHHHHHHHHHHHHHHTTcccEEEEcccTcHHHHHHHHHHHHHHHHTTccccGGGEEcccccHHHHHHHHHHHHTTccccEEEEccHHHHHHHHHHHTTccTTTTTTTcEEEEEcccTTGGTTccEE#cccEEEEEEEcHHHHHHHHHHHHHHTcccTTcEEEEcTTTTcEEcccccTTccHHHHHHHHHHHHHHH################## DISOP:02AL 358-360| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHccccccccccEEEEEEEEEHHHHHHHHHHHHHccccccccEEEEEEccccEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHcc //