[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yufP
DDBJ      :yufP         putative permease of ABC transporter
Swiss-Prot:YUFP_BACSU   RecName: Full=Uncharacterized ABC transporter permease protein yufP;

Homologs  Archaea  18/68 : Bacteria  311/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:348 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   193->284 PF02653 * BPD_transp_2 3e-08 36.7 %
:HMM:PFM   53->329 PF02653 * BPD_transp_2 7.5e-51 27.8 259/267  
:BLT:SWISS 1->348 YUFP_BACSU e-169 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15145.1 GT:GENE yufP GT:PRODUCT putative permease of ABC transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3242610..3243656 GB:FROM 3242610 GB:TO 3243656 GB:DIRECTION + GB:GENE yufP GB:PRODUCT putative permease of ABC transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB15145.1 GB:DB_XREF GOA:O05254 InterPro:IPR002229 SubtiList:BG12351 UniProtKB/Swiss-Prot:O05254 GB:GENE:GENE yufP LENGTH 348 SQ:AASEQ MVKRLSHLLVPLIAIILGLAAGALIMLVSGYSVASGYSALWNGIFGEIYYVGETIRQITPYILSGLAVAFAFRTGLFNIGVEGQLLVGWTAAVWVGTAFDGPAYIHLPLALITAAAAGGLWGFIPGILKARFYVHEVIVTIMMNYIALHMTNYIISNVLTDHQDKTGKIHESASLRSPFLEQITDYSRLHLGIIVALLAAVIMWFIINKSTKGFELRAVGFNQHASQYAGMSVRKNIMTSMLISGAFAGLAGAMEGLGTFEYAAVKGAFTGVGFDGIAVALLGGNTAVGVVLAACLLGGLKIGALNMPIESGVPSEVVDIVIAIIILFVASSYAIRFVMGKLKKKGAN GT:EXON 1|1-348:0| SW:ID YUFP_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter permease protein yufP; SW:GN Name=yufP; OrderedLocusNames=BSU31560; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->348|YUFP_BACSU|e-169|100.0|348/348| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 8 TM:REGION 7->29| TM:REGION 34->56| TM:REGION 67->89| TM:REGION 115->137| TM:REGION 188->210| TM:REGION 236->258| TM:REGION 275->297| TM:REGION 317->339| SEG 12->25|liaiilglaagali| SEG 109->122|lalitaaaagglwg| SEG 287->300|avgvvlaacllggl| RP:PFM:NREP 1 RP:PFM:REP 193->284|PF02653|3e-08|36.7|90/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 53->329|PF02653|7.5e-51|27.8|259/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 467 OP:NHOMOORG 329 OP:PATTERN 112--1------------11-1-12--12-1------------------------1-1111---2--- --1-1-----------------------------------------111111111-11--112111-121--------1---1------------------------------------------111-121--1111111---11-1------1------------2111------------2111111-111--2-2-1221111111---11111111211111111142--------------------21-1--1--1----------111111222111111111111111111111111111111111111111112132411111111122---2122512112--1-11-2--112111111-12-------------121---1----22122121223-11-1--2-34--4225343445661----4213233323---------22---11-----------------------------------1-----------------31--------21111--111-1--1---11--2-----1--------------1-2-1122--1111----------1111-1-----------------------------112-------1-------1------1--1----------------------------------------------------------------------------------------------------------------2-3---------------------1----1-------------1-11-----------------------------------------1------11111111211----1-1111---111-1111----2622215111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 162-170, 345-348| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //