[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yufS
DDBJ      :yufS         putative bacteriocin
Swiss-Prot:YUFS_BACSU   RecName: Full=Uncharacterized protein yufS;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->71 YUFS_BACSU 4e-39 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15148.1 GT:GENE yufS GT:PRODUCT putative bacteriocin GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3246152..3246367) GB:FROM 3246152 GB:TO 3246367 GB:DIRECTION - GB:GENE yufS GB:PRODUCT putative bacteriocin GB:FUNCTION 16.5: Explore 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16845009; Product type pf : putative factor GB:PROTEIN_ID CAB15148.1 GB:DB_XREF GOA:O05257 SubtiList:BG12354 UniProtKB/Swiss-Prot:O05257 GB:GENE:GENE yufS LENGTH 71 SQ:AASEQ MKTKVVMCSGLFCSVFAGAFMLNQYDGRSGVAACDEWELYLLEHHLSARMSETESKDLPFGPREYIRIVNK GT:EXON 1|1-71:0| SW:ID YUFS_BACSU SW:DE RecName: Full=Uncharacterized protein yufS; SW:GN Name=yufS; OrderedLocusNames=BSU31590; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|YUFS_BACSU|4e-39|100.0|71/100| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 4->24| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 49-57| PSIPRED cccEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHEEccc //