[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yugF
DDBJ      :yugF         putative hydrolase
Swiss-Prot:YUGF_BACSU   RecName: Full=Uncharacterized hydrolase yugF;         EC=3.1.-.-;

Homologs  Archaea  5/68 : Bacteria  406/915 : Eukaryota  88/199 : Viruses  1/175   --->[See Alignment]
c.69.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->271 2d0dA PDBj 2e-18 28.0 %
:RPS:PDB   12->273 3e3aB PDBj 2e-39 22.3 %
:RPS:SCOP  8->273 1c4xA  c.69.1.10 * 4e-39 24.2 %
:HMM:SCOP  6->273 1ehyA_ c.69.1.11 * 8.9e-61 31.6 %
:RPS:PFM   56->255 PF00561 * Abhydrolase_1 2e-15 34.9 %
:HMM:PFM   54->269 PF00561 * Abhydrolase_1 1e-25 25.7 214/231  
:HMM:PFM   14->79 PF12146 * Hydrolase_4 5.7e-06 21.2 66/79  
:BLT:SWISS 1->273 YUGF_BACSU e-159 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15131.1 GT:GENE yugF GT:PRODUCT putative hydrolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3227581..3228402 GB:FROM 3227581 GB:TO 3228402 GB:DIRECTION + GB:GENE yugF GB:PRODUCT putative hydrolase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB15131.1 GB:DB_XREF GOA:O05235 InterPro:IPR000639 SubtiList:BG12360 UniProtKB/Swiss-Prot:O05235 GB:GENE:GENE yugF LENGTH 273 SQ:AASEQ MEAVSPIRRFTVDGVNVYYEHYQNPGRQTLVCVHGFLSSAFSFRKVIPLLRDKYDIIALDLPPFGQSEKSRTFIYTYQNLAKLVIGILEHLQVKQAVLVGHSMGGQISLSAALQKPELFSKVVLLCSSGYLKRSHPTIIFGTHIPYFHLYIKRWLSKEGVMKNLLNVVHDKSLIDEEMIDGYGRPFQDEQIFKAMTRFIRHREGDLEPEQLKKMNKPALLIWGEEDRIVPMEIGKRLHADLPNSVLYSLGQTGHLVPEERPELISEHIADFIK GT:EXON 1|1-273:0| SW:ID YUGF_BACSU SW:DE RecName: Full=Uncharacterized hydrolase yugF; EC=3.1.-.-; SW:GN Name=yugF; OrderedLocusNames=BSU31420; SW:KW Complete proteome; Hydrolase; Serine esterase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->273|YUGF_BACSU|e-159|100.0|273/273| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004091|"GO:carboxylesterase activity"|Serine esterase| BL:PDB:NREP 1 BL:PDB:REP 21->271|2d0dA|2e-18|28.0|239/271| RP:PDB:NREP 1 RP:PDB:REP 12->273|3e3aB|2e-39|22.3|256/275| RP:PFM:NREP 1 RP:PFM:REP 56->255|PF00561|2e-15|34.9|189/211|Abhydrolase_1| HM:PFM:NREP 2 HM:PFM:REP 54->269|PF00561|1e-25|25.7|214/231|Abhydrolase_1| HM:PFM:REP 14->79|PF12146|5.7e-06|21.2|66/79|Hydrolase_4| RP:SCP:NREP 1 RP:SCP:REP 8->273|1c4xA|4e-39|24.2|260/281|c.69.1.10| HM:SCP:REP 6->273|1ehyA_|8.9e-61|31.6|263/293|c.69.1.11|1/1|alpha/beta-Hydrolases| OP:NHOMO 1162 OP:NHOMOORG 500 OP:PATTERN -----------------------1---1--------------------------------1-----11 22--3---------43111-14--341111117434-188-23--2---11-1-------113---3851-----------12----------------1-332195212--------------1432344222334666511-529987876544411-12-5457BBE83112211-1221111-1----12666666553756655211123666---1-1--1-211-5----1-1-11---11--1---------1---------------------------------------------------------------23111111-1-11---11----111-------11-----1----2------31111-----55533---11212111111---1--1151-512122--11-2-1134332211---11111--311111111-12--121---1111111---------1----------1162-21111422334-----1144------7463432--22-11-1-1131-1-11---1--------------517211----------121-1-2--221222131-----------------------------21-314222-111242----2-12-23---111------------11------------------------------2123122-----------------1-----------------------1111111-1----311---11111111111-122221--122-334322-343332-312----------111222222---------1-------------111122----------1------1--1--1---11-------3-1-1-2----2- -1--1----------1-------1-1--------------------11231-22--111----1--1-----1--11111---------11--------1----------6312232---11112--2-131-1111-1-1-11--1--1---211-1352-1-31--129-134-211T32326922A15911-2-1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-- STR:NPRED 273 STR:RPRED 100.0 SQ:SECSTR cccccccccEEccccEEEEEEEEEcccEEEEEEccTTccGGGGTTHHHHHHTTEEEEEEccTTcGGGTTcccccccHHHHHHHHHHHHHHTTcccEEEEEETHHHHHHHHHHHHcGGGEEEEEEEcccccccHHHHTTHHHHHHHHHHHTTccccHHHHHHHHHHHHccHHHHTcHHHHHHHHHHHHHcccccHHHHHTTcccccccGGGGGGccccEEEEEETTcccccHHHHHHHHHHcTTEEEEEETTccTTHHHHcHHHHHHHHHHHHH DISOP:02AL 1-2| PSIPRED ccccccEEEEEEccEEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHcHHHHcEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHc //