[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yugI
DDBJ      :yugI         putative RNA degradation protein; putative phosphorylase or nucleotidyl transferase
Swiss-Prot:GS13_BACSU   RecName: Full=General stress protein 13;         Short=GSP13;

Homologs  Archaea  17/68 : Bacteria  710/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->130 2k4kA PDBj 1e-59 100.0 %
:RPS:PDB   1->78 3bzkA PDBj 2e-18 39.7 %
:RPS:SCOP  3->77 1sroA  b.40.4.5 * 1e-18 51.4 %
:HMM:SCOP  5->90 1go3E1 b.40.4.5 * 9.9e-25 43.5 %
:RPS:PFM   6->75 PF00575 * S1 1e-12 50.0 %
:HMM:PFM   4->77 PF00575 * S1 7.2e-25 48.6 74/74  
:HMM:PFM   78->121 PF09110 * HAND 0.00085 20.5 44/112  
:BLT:SWISS 1->130 GS13_BACSU 4e-59 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15128.1 GT:GENE yugI GT:PRODUCT putative RNA degradation protein; putative phosphorylase or nucleotidyl transferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3225178..3225570) GB:FROM 3225178 GB:TO 3225570 GB:DIRECTION - GB:GENE yugI GB:PRODUCT putative RNA degradation protein; putative phosphorylase or nucleotidyl transferase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16014871, 9862121; Product type pe: putative enzyme GB:PROTEIN_ID CAB15128.1 GB:DB_XREF GOA:P80870 InterPro:IPR000110 PDB:2K4K SubtiList:BG12363 UniProtKB/Swiss-Prot:P80870 GB:GENE:GENE yugI LENGTH 130 SQ:AASEQ MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK GT:EXON 1|1-130:0| SW:ID GS13_BACSU SW:DE RecName: Full=General stress protein 13; Short=GSP13; SW:GN Name=yugI; OrderedLocusNames=BSU31390; SW:KW 3D-structure; Complete proteome; Cytoplasm; Direct protein sequencing;Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|GS13_BACSU|4e-59|100.0|130/130| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006950|"GO:response to stress"|Stress response| SEG 81->96|aapekkeskprkpkaa| BL:PDB:NREP 1 BL:PDB:REP 1->130|2k4kA|1e-59|100.0|130/130| RP:PDB:NREP 1 RP:PDB:REP 1->78|3bzkA|2e-18|39.7|78/728| RP:PFM:NREP 1 RP:PFM:REP 6->75|PF00575|1e-12|50.0|70/74|S1| HM:PFM:NREP 2 HM:PFM:REP 4->77|PF00575|7.2e-25|48.6|74/74|S1| HM:PFM:REP 78->121|PF09110|0.00085|20.5|44/112|HAND| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 1 RP:SCP:REP 3->77|1sroA|1e-18|51.4|74/76|b.40.4.5| HM:SCP:REP 5->90|1go3E1|9.9e-25|43.5|85/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1391 OP:NHOMOORG 755 OP:PATTERN -----------------------11111--11---11-11112------------1-11--------- 322-111----1-111111-11111111111111111111112211-1111-11111111111--11211-1111----22-----1-11111---1--2------122122222222221111312211111-113223211-2122233321122---1-1-2-1111211-----1----22222--124444444344444444432444344444434334444442132233333333323243454413133122123322334322213223333222222333333333323333333333333322333222217434333333333331443122143342211144112152-2221-1-11131112-------2--11-12-12-------------------------111--1-------1--11122221-111111111---2-22111211111--1111111111111-1-1--121222222221111111111111221111111122222111122233321113111232-21211111112111112-211121111222-33312241133132211-------------------------222121322112211111112111111221121-2233111211131122113333333333-3333333323333333333111111211111-11--1111111233333331-2111111111111-2111111-----1221222211222131-1211111112122122221111-11112-11-11111111222212222222222--21211222111111-1-------------11-1----1---------------------11------1222 ---------------11----1-----------1-1----------------------------1---------------------------1---------------2---------------------------------------------------------------1--21114111117345-3911----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 100.0 SQ:SECSTR cGGGccTTcEEEEEEEEEETTEEEEEccccccEEEEGGGGcccccccHHHHccTTcEEEEEEEEEETTTTEEEEEccTTTHccccccccTTTTcTTcccccccccccccccccTTccccccccccGGGcc DISOP:02AL 79-108, 129-130| PSIPRED cccccccccEEEEEEEEEEccEEEEEEccccEEEEEEEEccccccccHHHEEEcccEEEEEEEEEEccccEEEEEEEEccccccHHHHccccccccccEEEcccccccccHHHHHHHHHccccHHHcccc //