[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yuiA
DDBJ      :yuiA         conserved hypothetical protein
Swiss-Prot:YUIA_BACSU   RecName: Full=Uncharacterized protein yuiA;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->38 1exkA PDBj 7e-04 46.9 %
:HMM:PFM   2->42 PF00684 * DnaJ_CXXCXGXG 3.9e-07 25.6 39/79  
:BLT:SWISS 1->47 YUIA_BACSU 2e-25 100.0 %
:REPEAT 2|9->19|28->38

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15199.1 GT:GENE yuiA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3299718..3299861) GB:FROM 3299718 GB:TO 3299861 GB:DIRECTION - GB:GENE yuiA GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15199.1 GB:DB_XREF HSSP:1EXK SubtiList:BG12389 UniProtKB/Swiss-Prot:O32110 GB:GENE:GENE yuiA LENGTH 47 SQ:AASEQ MKTATTTASHACPFCSGKGYFQLILGGSETCPSCQGTGKDSHSFSSR GT:EXON 1|1-47:0| SW:ID YUIA_BACSU SW:DE RecName: Full=Uncharacterized protein yuiA; SW:GN Name=yuiA; Synonyms=yumA; OrderedLocusNames=BSU32090; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->47|YUIA_BACSU|2e-25|100.0|47/47| NREPEAT 1 REPEAT 2|9->19|28->38| BL:PDB:NREP 1 BL:PDB:REP 7->38|1exkA|7e-04|46.9|32/79| HM:PFM:NREP 1 HM:PFM:REP 2->42|PF00684|3.9e-07|25.6|39/79|DnaJ_CXXCXGXG| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 32 STR:RPRED 68.1 SQ:SECSTR ######cccEEcTTTTTccEEEEEETTEEEcTTTTTcc######### DISOP:02AL 1-7, 37-47| PSIPRED cccccccccccccccccccEEEEEEcccccccccccccccccccccc //