[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yuiD
DDBJ      :yuiD         putative integral inner membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->117 PF02681 * DUF212 4e-27 50.9 %
:HMM:PFM   3->149 PF02681 * DUF212 9.3e-59 59.3 140/141  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15196.1 GT:GENE yuiD GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3298077..3298553 GB:FROM 3298077 GB:TO 3298553 GB:DIRECTION + GB:GENE yuiD GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB15196.1 GB:DB_XREF InterPro:IPR003832 SubtiList:BG13969 UniProtKB/TrEMBL:O32107 GB:GENE:GENE yuiD LENGTH 158 SQ:AASEQ MELLTNFPLLSSLAAIIFAQVIKVPIQFIVSRKLDWSLVTSTGGMPSSHSAAVTALSTGVALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAAEKEKQKKLKELLGHQPIEVFFGGLTGILLTLVLAYFFM GT:EXON 1|1-158:0| TM:NTM 3 TM:REGION 5->27| TM:REGION 66->88| TM:REGION 137->158| SEG 118->132|kaaekekqkklkell| SEG 139->153|vffggltgilltlvl| RP:PFM:NREP 1 RP:PFM:REP 4->117|PF02681|4e-27|50.9|114/137|DUF212| HM:PFM:NREP 1 HM:PFM:REP 3->149|PF02681|9.3e-59|59.3|140/141|DUF212| OP:NHOMO 155 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------1-----------1111111111111-111111-111111111111111111111---211-----1--1---1--111111----1111-11111111--------------------------------------------111--------------------------------------------111-------------1--------1-------11-1--11-----1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-1-------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------223J333125536-42------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 118-125| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //