[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yulC
DDBJ      :yulC         rhamnulokinase
Swiss-Prot:RHAB_BACSU   RecName: Full=Rhamnulokinase;         EC=2.7.1.5;AltName: Full=Rhamnulose kinase;

Homologs  Archaea  3/68 : Bacteria  219/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->463 2uytA PDBj 5e-97 42.8 %
:RPS:PDB   3->464 2dpnA PDBj 4e-56 20.6 %
:RPS:SCOP  3->241 2p3rA1  c.55.1.4 * 6e-35 18.9 %
:RPS:SCOP  245->464 1bo5O2  c.55.1.4 * 8e-24 14.0 %
:HMM:SCOP  1->242 1r59O1 c.55.1.4 * 5e-47 28.0 %
:HMM:SCOP  245->464 1r59O2 c.55.1.4 * 8.2e-34 25.7 %
:RPS:PFM   6->240 PF00370 * FGGY_N 5e-17 27.2 %
:RPS:PFM   361->438 PF02782 * FGGY_C 2e-05 30.8 %
:HMM:PFM   3->240 PF00370 * FGGY_N 9e-39 28.0 236/245  
:HMM:PFM   250->439 PF02782 * FGGY_C 5.3e-22 22.0 186/197  
:BLT:SWISS 1->485 RHAB_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15098.1 GT:GENE yulC GT:PRODUCT rhamnulokinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3199565..3201022) GB:FROM 3199565 GB:TO 3201022 GB:DIRECTION - GB:GENE yulC GB:PRODUCT rhamnulokinase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 16674975; Product type e: enzyme GB:PROTEIN_ID CAB15098.1 GB:DB_XREF GOA:O05262 InterPro:IPR013449 SubtiList:BG12385 UniProtKB/Swiss-Prot:O05262 GB:GENE:GENE yulC LENGTH 485 SQ:AASEQ MIYTAIDVGASSGRIMVGELNEGKLDIQEIHRFANGFSQRDGHCLWDIDHLLKQILQGLQKVKTLGYEHCTVGIDTWAVDYVLLDEKGDRLREAISYRDRRTDHTIDKLEHTLSKAAIYQKTGIQFQPFNTIYQLFEEDRELLKKTDKIMMIPDYLGYCLTGKAVTEITNVSTTQLLNVSTGNLDPELLEAVSVLEQQFAPLTEPGCELGKLRNEWFPDYDLPACKVMTVATHDTASAVIAAPGVNDGWAYISSGTWSLIGVENKTPIITDLALENNYTNERGANNTIRFLKNIIGMWVIQEVKQQLQADYSFQQLAEEAKKTEPFQQFINLNDKRFLNPENMIKEIQHYCRQTRQKIPRTAGELACCIYSNLAIIYAIAIKELETITEKPIEQFHIIGGGARNDFLNQLTADMSGKAVYAGPIEATATGNLLMQMIAAKEVKDIKEARQVVRNSFPIKVFTPKDIDRSTIIQSFQQTVLKALSK GT:EXON 1|1-485:0| SW:ID RHAB_BACSU SW:DE RecName: Full=Rhamnulokinase; EC=2.7.1.5;AltName: Full=Rhamnulose kinase; SW:GN Name=rhaB; Synonyms=yulC; OrderedLocusNames=BSU31200; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Rhamnose metabolism; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->485|RHAB_BACSU|0.0|100.0|485/485| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0019299|"GO:rhamnose metabolic process"|Rhamnose metabolism| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 5->463|2uytA|5e-97|42.8|451/479| RP:PDB:NREP 1 RP:PDB:REP 3->464|2dpnA|4e-56|20.6|447/492| RP:PFM:NREP 2 RP:PFM:REP 6->240|PF00370|5e-17|27.2|232/245|FGGY_N| RP:PFM:REP 361->438|PF02782|2e-05|30.8|78/191|FGGY_C| HM:PFM:NREP 2 HM:PFM:REP 3->240|PF00370|9e-39|28.0|236/245|FGGY_N| HM:PFM:REP 250->439|PF02782|5.3e-22|22.0|186/197|FGGY_C| GO:PFM:NREP 4 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00370|IPR018484| GO:PFM GO:0016773|"GO:phosphotransferase activity, alcohol group as acceptor"|PF00370|IPR018484| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02782|IPR018485| GO:PFM GO:0016773|"GO:phosphotransferase activity, alcohol group as acceptor"|PF02782|IPR018485| RP:SCP:NREP 2 RP:SCP:REP 3->241|2p3rA1|6e-35|18.9|233/252|c.55.1.4| RP:SCP:REP 245->464|1bo5O2|8e-24|14.0|215/246|c.55.1.4| HM:SCP:REP 1->242|1r59O1|5e-47|28.0|236/0|c.55.1.4|1/1|Actin-like ATPase domain| HM:SCP:REP 245->464|1r59O2|8.2e-34|25.7|214/0|c.55.1.4|1/1|Actin-like ATPase domain| OP:NHOMO 316 OP:NHOMOORG 223 OP:PATTERN -----------------1-----11------------------------------------------- 1-1-1--1111--------------1-------1111-2----1112-----111---------1-111-------------1-----1121-1-----------1------------------------------11111------------------------------------------11---12-1-1111112311121212112211111111-1--11111--3--------------------11---1-1111111132-11----------------11111111111-----------------------21-11-------1-------11-2-----1---------1------2-----1-----------------------------------------------------11--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------1---------------------------------3211-1-2221222222-2223222222222222221332121--2222222222222222-11211121--22222222222------------------1111-1-111-2111-------------------11-----------------------------1-1------------------------------------------------------------1-2--21222-11 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 484 STR:RPRED 99.8 SQ:SECSTR cEEEEEEEcccEEEEEEEcTTccEEEEEEccEEcccTTccEEcHHHHHHHHHHHHHHHHHHTTccGGGccEEEEEEcccccEEETTTccccccEEcTTccTTHHHHHHHHHTTcHHHHHHHTcccccTTcHHHHHHHHcccHHHHHHHTccHHHHHHHHHTTTcEEcHHHHTTcccEETTTTEEcHHHHHHTTcccTTccEEccTTcccccccHHHHcEEcccccccEEEEEEHHHHHHHHTTcccTTcEEEEEccEEEEEEcTTcccccccccEEEEEEEETTEEEEEEEEEEcccHHHHHHHHTTccccTHHHHHHTcccccccEEEccTTccTTTccTTcccEEEcccTTcTccccccHHHHHHHHHHHHHHHHHHHHHHHHTTTccccccEEEEcGGGGcHHHHHHHHHHHTccEEEEcccHHHHHHHHHHHHHHTcccHHHHHHHHccHHcEEEEEccccTTcHHHHHHHHHHHHTTTT# DISOP:02AL 484-486| PSIPRED cEEEEEEEccccEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEccccccccccHHccccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHEEcHHHHHHHHHHccEEEEHHcccccccccHHHccccHHHHHHccccHHHcccccccccccccccHHHHHHcccccccEEEEEccHHHHHHHcccccccccEEEEEcccEEEEEEccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHcc //