[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yusO
DDBJ      :yusO         putative transcriptional regulator (MarR family)
Swiss-Prot:YUSO_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator yusO;

Homologs  Archaea  3/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->145 1s3jA PDBj 2e-61 100.0 %
:RPS:PDB   15->148 2a61A PDBj 4e-16 24.6 %
:RPS:SCOP  3->145 1s3jA  a.4.5.28 * 6e-18 95.1 %
:HMM:SCOP  5->141 1jgsA_ a.4.5.28 * 4.5e-27 36.0 %
:RPS:PFM   35->91 PF01047 * MarR 1e-05 45.6 %
:HMM:PFM   35->92 PF01047 * MarR 3.1e-22 43.1 58/59  
:BLT:SWISS 1->155 YUSO_BACSU 3e-82 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15276.1 GT:GENE yusO GT:PRODUCT putative transcriptional regulator (MarR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3374492..3374959 GB:FROM 3374492 GB:TO 3374959 GB:DIRECTION + GB:GENE yusO GB:PRODUCT putative transcriptional regulator (MarR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12923086; Product type pr : putative regulator GB:PROTEIN_ID CAB15276.1 GB:DB_XREF GOA:O32181 InterPro:IPR011991 PDB:1S3J SubtiList:BG14027 UniProtKB/Swiss-Prot:O32181 GB:GENE:GENE yusO LENGTH 155 SQ:AASEQ MKSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETDEKQNMKRGNG GT:EXON 1|1-155:0| SW:ID YUSO_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator yusO; SW:GN Name=yusO; OrderedLocusNames=BSU32870; SW:KW 3D-structure; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|YUSO_BACSU|3e-82|100.0|155/155| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 3->145|1s3jA|2e-61|100.0|136/136| RP:PDB:NREP 1 RP:PDB:REP 15->148|2a61A|4e-16|24.6|134/142| RP:PFM:NREP 1 RP:PFM:REP 35->91|PF01047|1e-05|45.6|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 35->92|PF01047|3.1e-22|43.1|58/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 3->145|1s3jA|6e-18|95.1|143/143|a.4.5.28| HM:SCP:REP 5->141|1jgsA_|4.5e-27|36.0|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 150 OP:NHOMOORG 99 OP:PATTERN ---------------------------------------------------1----------11---- -------1111-1-------------------------11---1--------1-------------111------------1-----------------------------------------------------------1--------11---------------------------------------125222221121222112-1773622123111--11111124-------------------1-------1---------------------------------------------------------------111-------------22-11------1--11---312--1---------------------------------------------11-11-1-----------1---21--------------1------------------------------------------------1---111----------------------------------------------------------------11--1---------11----1--2--2-------------------------------------1--------1-----1---------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 98.1 SQ:SECSTR cccHHHHHTcHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcHHHH### DISOP:02AL 1-4, 142-155| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccc //