[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yusQ
DDBJ      :yusQ         putative tautomerase
Swiss-Prot:YUSQ_BACSU   RecName: Full=Probable tautomerase yusQ;         EC=5.3.2.-;

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:127 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->126 2aagB PDBj 4e-16 27.4 %
:RPS:PDB   2->124 2aagA PDBj 7e-22 27.9 %
:RPS:SCOP  2->124 2aagA1  d.80.1.6 * 2e-22 27.9 %
:HMM:SCOP  2->127 2aalA1 d.80.1.6 * 4.1e-38 40.0 %
:RPS:PFM   68->119 PF01361 * Tautomerase 3e-06 32.7 %
:HMM:PFM   2->49 PF01361 * Tautomerase 2.1e-10 27.1 48/60  
:HMM:PFM   68->119 PF01361 * Tautomerase 4.1e-08 30.8 52/60  
:HMM:PFM   32->83 PF06226 * DUF1007 2.4e-05 25.0 52/213  
:BLT:SWISS 1->127 YUSQ_BACSU 2e-71 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15278.1 GT:GENE yusQ GT:PRODUCT putative tautomerase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3376617..3377000) GB:FROM 3376617 GB:TO 3377000 GB:DIRECTION - GB:GENE yusQ GB:PRODUCT putative tautomerase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB15278.1 GB:DB_XREF GOA:O32183 InterPro:IPR014347 SubtiList:BG14029 UniProtKB/Swiss-Prot:O32183 GB:GENE:GENE yusQ LENGTH 127 SQ:AASEQ MPFVQIHLRSGRSEVWLQKLSRTIHQSMIEEINVPEDDYFQVIRQYEKSEFFYDPFYLQVERTDELIYIHFTLKQSRTTEQKKALYRSIASRIHSELGVRKEDVFIMLAGNQDEDWSFGNGRAQMIE GT:EXON 1|1-127:0| SW:ID YUSQ_BACSU SW:DE RecName: Full=Probable tautomerase yusQ; EC=5.3.2.-; SW:GN Name=yusQ; OrderedLocusNames=BSU32890; SW:KW Complete proteome; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->127|YUSQ_BACSU|2e-71|100.0|127/127| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 2->126|2aagB|4e-16|27.4|124/130| RP:PDB:NREP 1 RP:PDB:REP 2->124|2aagA|7e-22|27.9|122/129| RP:PFM:NREP 1 RP:PFM:REP 68->119|PF01361|3e-06|32.7|52/59|Tautomerase| HM:PFM:NREP 3 HM:PFM:REP 2->49|PF01361|2.1e-10|27.1|48/60|Tautomerase| HM:PFM:REP 68->119|PF01361|4.1e-08|30.8|52/60|Tautomerase| HM:PFM:REP 32->83|PF06226|2.4e-05|25.0|52/213|DUF1007| GO:PFM:NREP 2 GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF01361|IPR004370| GO:PFM GO:0016853|"GO:isomerase activity"|PF01361|IPR004370| RP:SCP:NREP 1 RP:SCP:REP 2->124|2aagA1|2e-22|27.9|122/129|d.80.1.6| HM:SCP:REP 2->127|2aalA1|4.1e-38|40.0|125/0|d.80.1.6|1/1|Tautomerase/MIF| OP:NHOMO 124 OP:NHOMOORG 113 OP:PATTERN -------------------------------------------------------------------- 11--1---------11---------------------------------11-11------------1-2---------------------------------------------------------------------------------------------1------------------------------211111-111111--1--11-3-11-----1------1-1-------------------------1---------11----------------------------------------------------------------------------------------------------------1--------121-1------1-------------11-11111----1---11-121--11----1--------11111111---1-------------------------------------------21111111111111-11111-1211-1-2------1---2-1-----------------------1-------------------------1111--------------------------------1------------------------------------------------------------------------------111-1-------------------1----------------------------------------------------------------------1-1----------------------------------12----------------------------------------------------------------------- -----------------------1-------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 100.0 SQ:SECSTR EcEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccTTcccEEEEEEcGGGcccccTTccccccTTcEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEccGGGccccTTccHccT PSIPRED cccEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccEEEccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEcHHHcccccHHHHHcc //