[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yusR
DDBJ      :yusR         putative 3-oxoacyl-acyl-carrier protein reductase
Swiss-Prot:YUSR_BACSU   RecName: Full=Short-chain dehydrogenase/reductase homolog yusR;

Homologs  Archaea  27/68 : Bacteria  482/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->129 2uvdA PDBj 2e-13 31.8 %
:RPS:PDB   2->129 1a27A PDBj 5e-18 21.9 %
:RPS:SCOP  3->129 1pwxA  c.2.1.2 * 3e-21 21.3 %
:HMM:SCOP  1->129 1p33A_ c.2.1.2 * 1.3e-30 40.3 %
:RPS:PFM   3->56 PF00106 * adh_short 4e-05 37.0 %
:HMM:PFM   2->59 PF00106 * adh_short 4.7e-10 25.9 54/167  
:BLT:SWISS 1->129 YUSR_BACSU 4e-62 100.0 %
:PROS 28->56|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15279.1 GT:GENE yusR GT:PRODUCT putative 3-oxoacyl-acyl-carrier protein reductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3377019..3377408) GB:FROM 3377019 GB:TO 3377408 GB:DIRECTION - GB:GENE yusR GB:PRODUCT putative 3-oxoacyl-acyl-carrier protein reductase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB15279.1 GB:DB_XREF GOA:O32184 InterPro:IPR016040 SubtiList:BG14030 UniProtKB/Swiss-Prot:O32184 GB:GENE:GENE yusR LENGTH 129 SQ:AASEQ MKGMFFCARAVVPFMKKSKDGAIVNVGSIAGITGAGSSMPYAVSKSAVHGLTKSLAHALAPEIRVSGVAPGAVATRWWAGREEKMKSMIGSLLLQCIAEPDDVAKLICSLIEQESLTGQIITIDSGQTL GT:EXON 1|1-129:0| SW:ID YUSR_BACSU SW:DE RecName: Full=Short-chain dehydrogenase/reductase homolog yusR; SW:GN Name=yusR; OrderedLocusNames=BSU32900; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|YUSR_BACSU|4e-62|100.0|129/129| PROS 28->56|PS00061|ADH_SHORT|PDOC00060| SEG 27->38|gsiagitgagss| BL:PDB:NREP 1 BL:PDB:REP 1->129|2uvdA|2e-13|31.8|129/246| RP:PDB:NREP 1 RP:PDB:REP 2->129|1a27A|5e-18|21.9|128/285| RP:PFM:NREP 1 RP:PFM:REP 3->56|PF00106|4e-05|37.0|54/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 2->59|PF00106|4.7e-10|25.9|54/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 3->129|1pwxA|3e-21|21.3|127/252|c.2.1.2| HM:SCP:REP 1->129|1p33A_|1.3e-30|40.3|129/284|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 870 OP:NHOMOORG 562 OP:PATTERN --1-1-1332423221-3222-1--------1-----------1---1--11--1-----111-1--- 1-2-1-----111-13311-15--1811111145551141---1-1---1---1--------2-1--4111-111----11-2-----11---111---111-1-2---1--------------121222222212433231111-11222211111------1-11112----1-----1--1----221222111111111111111323313111212211-11111122-11111111111111211112-211111-1-111111111111111111111111-1111111111111111111111111111111111113-1222222212112221122-2-1-13-1-11112-121233311--2113226-------7-----1--1111111111113---2-14-1342-411143351233212--2-22113-2---------2--1---1-----------------------------1173--11-1-1113121222222333222223451411--11--1331123212-1-1211---------11111-14-1-1----11111233122221----42------------------------1--441111321-32-11-----3----2-21--1----1-2--------11--------------------------------1122--11-1111111111111111-------------------------------22221123-----------------------1--31-------2-1-2-1-12---------1------------------------1111-1-1--2211----------1-------------------------1122111121--- ------1-------112211-2-21-211-----------------111122-2-------------------1------------------2------1---------1432111-------------121---1---------1----------1-1111-2----11-1111-1------1-2---1-1----1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR THHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGEEEEEEEEccccccTTTTHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEcccTTHHH DISOP:02AL 129-130| PSIPRED cHHHHHHHHHHHHHHHHcccccEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccEEEEcccccc //