[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yusW
DDBJ      :yusW         putative lipoprotein
Swiss-Prot:YUSW_BACSU   RecName: Full=Uncharacterized protein yusW;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->137 PF06548 * Kinesin-related 0.00024 17.2 122/469  
:BLT:SWISS 1->145 YUSW_BACSU 2e-80 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15284.1 GT:GENE yusW GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3380157..3380594) GB:FROM 3380157 GB:TO 3380594 GB:DIRECTION - GB:GENE yusW GB:PRODUCT putative lipoprotein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pm: putative membrane component GB:PROTEIN_ID CAB15284.1 GB:DB_XREF SubtiList:BG14035 UniProtKB/Swiss-Prot:O32189 GB:GENE:GENE yusW LENGTH 145 SQ:AASEQ MHLIRAAGAVCLAVVLIAGCRFNEDQHQAEGENTAVTQLKSVPYSNFSLRVSYGDGEHNRYEGIYTKNGTQEKAEIQDKLSGVNQEGEEALDEMKMILSELSVTDQMAETEVIHSVLAAFNLDSHYDHIDLKLKLKDGSIREIKK GT:EXON 1|1-145:0| SW:ID YUSW_BACSU SW:DE RecName: Full=Uncharacterized protein yusW;Flags: Precursor; SW:GN Name=yusW; OrderedLocusNames=BSU32950; SW:KW Coiled coil; Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->145|YUSW_BACSU|2e-80|100.0|145/145| TM:NTM 1 TM:REGION 1->20| HM:PFM:NREP 1 HM:PFM:REP 14->137|PF06548|0.00024|17.2|122/469|Kinesin-related| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-1111-1--111111----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 25-34, 141-145| PSIPRED cHHHHHHHHHHHHHHHHcccccccHHHccccccccHHHHHccccEEEEEEEccccccccEEEEEEcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHcc //