[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yusZ
DDBJ      :yusZ         putative short-chain acyl dehydrogenase
Swiss-Prot:YUSZ_BACSU   RecName: Full=Uncharacterized oxidoreductase yusZ;         EC=1.-.-.-;AltName: Full=ORFA;

Homologs  Archaea  49/68 : Bacteria  850/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:280 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->249 1iolA PDBj 2e-26 32.2 %
:RPS:PDB   3->279 3deyX PDBj 4e-47 32.0 %
:RPS:SCOP  3->279 1a27A  c.2.1.2 * 2e-45 28.1 %
:HMM:SCOP  2->243 1jtvA_ c.2.1.2 * 6.7e-59 36.1 %
:RPS:PFM   4->169 PF00106 * adh_short 2e-26 41.7 %
:HMM:PFM   4->170 PF00106 * adh_short 8.7e-36 25.9 162/167  
:HMM:PFM   94->257 PF08643 * DUF1776 8.5e-08 28.2 163/299  
:BLT:SWISS 1->280 YUSZ_BACSU e-159 100.0 %
:PROS 139->167|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15287.1 GT:GENE yusZ GT:PRODUCT putative short-chain acyl dehydrogenase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3382633..3383475 GB:FROM 3382633 GB:TO 3383475 GB:DIRECTION + GB:GENE yusZ GB:PRODUCT putative short-chain acyl dehydrogenase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB15287.1 GB:DB_XREF GOA:P37959 HSSP:1FDU InterPro:IPR016040 SubtiList:BG10863 UniProtKB/Swiss-Prot:P37959 GB:GENE:GENE yusZ LENGTH 280 SQ:AASEQ MNKKIAIVTGASSGFGLLAAVKLARSFFVIATSRQPEKAEQLRELAAAHNVSDSIHITALDVTDEQSIVSFGKAVSAYAPIDLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTKTVLPYIRKHGGAKIINVSSISGLTGFPALSPYVSSKHALEGFSESLRIELLPFGIETALIEPGSYKTSIWSTSLSNFMSVPADDSAYHQYYKKILSYVQKNGEESGDPQEVADLIYQLATKQHIKNLRYPIGKGIKLTLLFRSLFPWSAWESILKKKLFS GT:EXON 1|1-280:0| SW:ID YUSZ_BACSU SW:DE RecName: Full=Uncharacterized oxidoreductase yusZ; EC=1.-.-.-;AltName: Full=ORFA; SW:GN Name=yusZ; Synonyms=yvxA; OrderedLocusNames=BSU32980; SW:KW Complete proteome; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->280|YUSZ_BACSU|e-159|100.0|280/280| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 139->167|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 3->249|1iolA|2e-26|32.2|245/284| RP:PDB:NREP 1 RP:PDB:REP 3->279|3deyX|4e-47|32.0|269/277| RP:PFM:NREP 1 RP:PFM:REP 4->169|PF00106|2e-26|41.7|163/169|adh_short| HM:PFM:NREP 2 HM:PFM:REP 4->170|PF00106|8.7e-36|25.9|162/167|adh_short| HM:PFM:REP 94->257|PF08643|8.5e-08|28.2|163/299|DUF1776| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 3->279|1a27A|2e-45|28.1|274/285|c.2.1.2| HM:SCP:REP 2->243|1jtvA_|6.7e-59|36.1|241/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 12919 OP:NHOMOORG 1092 OP:PATTERN 111-12455464544224-111-19446644911---------21154--722-12--1-3-543155 CHO2c31466A785dmcMM-Md66X*MLMMMTnrrsSr*x3PDXF7883FA2HDA73811HDH5JDQTSE711111122276P112-15594-412---97V4DB*BZ7I1111111-------43438A633665BCCAD111D7LEJH8776622121344343AKIX7323232223222EB96666-E7KDDDDDDEFDFEEFGCGCJJCNEDBADDFIH9877786GY644444344455443A886A62828A251218C556665638B988667666634434444444444576677777777734333244453258C55554454456399278544111383-14412122512223242492BaBBH12111QCdPP257KGHEGAABA9ACABBL-GHJHESJORdN2oYYMkabiqhfaFODI7DEMFBCEBAF66666666FGIA49B7--111111---1-111-----1--1---16AUX778GD9OigidjdMHHHHTTjeLJKLBKuQnMlcP26KKK8AEABI9UFSJ7E94879852222222349IA6AK6A31121-222226893A22837B97JP25211112211311311111113131333B8ACDDD9I98653451E7866584686691-3455811-1118FFM3FA9AA7988899-A899978999A78999998HMJF798A9699AAA99A889899L6776548319999A9999AA91-1745434AAAA4BGLF222526211113234IJJLK9G6DBL5MNGLEDOPNJGJJFJEF7454464442366D66666AB98AAEEIHIG66674541133FF88A9--------2-3----2-1-2-1------31------33311445653B1 11-1fXC-622-57JOOTNYNPHWWUTABCDDDAFABGCFBDE967QIXkRantJQPJEDCE86E7753833GAE424564BBACCAC-W*JOBaD5668528OIH-CJD*p*ZZhMCCCDJYDicBWDj*X-UNUDKIBYEIYOAIHBDa59OKUSchdiOHxYcMVOUbJene77A3R322ALJDHkQRKEFaPXZ7 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 99.6 SQ:SECSTR cTcEEEEEcccccHHHHHHHHHHHHcEEEEEEEccGGGTHHHHHHHHHTTcTTcEEEEEccTTcHHHHHHHHHTcHTTccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEcccccccHHHHHTcHHHHTccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEcccTTTHHHHHHHHTcTTcHHHHHHHHHc# PSIPRED ccccEEEEEccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHccHHHHHHHHHHHHcc //