[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yutE
DDBJ      :yutE         conserved hypothetical protein
Swiss-Prot:YUTE_BACSU   RecName: Full=UPF0331 protein yutE;

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->143 1ylmA PDBj 8e-74 100.0 %
:RPS:SCOP  15->129 1wtyA  a.24.16.2 * 2e-09 10.7 %
:RPS:PFM   37->127 PF01934 * DUF86 1e-10 37.1 %
:HMM:PFM   27->129 PF01934 * DUF86 3.6e-21 25.7 101/119  
:BLT:SWISS 1->144 YUTE_BACSU 2e-80 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15220.1 GT:GENE yutE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3318828..3319262) GB:FROM 3318828 GB:TO 3319262 GB:DIRECTION - GB:GENE yutE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15220.1 GB:DB_XREF InterPro:IPR008201 PDB:1YLM SubtiList:BG14041 UniProtKB/Swiss-Prot:O32126 GB:GENE:GENE yutE LENGTH 144 SQ:AASEQ MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAFK GT:EXON 1|1-144:0| SW:ID YUTE_BACSU SW:DE RecName: Full=UPF0331 protein yutE; SW:GN Name=yutE; OrderedLocusNames=BSU32300; SW:KW 3D-structure; Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|YUTE_BACSU|2e-80|100.0|144/100| BL:PDB:NREP 1 BL:PDB:REP 2->143|1ylmA|8e-74|100.0|139/139| RP:PFM:NREP 1 RP:PFM:REP 37->127|PF01934|1e-10|37.1|89/118|DUF86| HM:PFM:NREP 1 HM:PFM:REP 27->129|PF01934|3.6e-21|25.7|101/119|DUF86| RP:SCP:NREP 1 RP:SCP:REP 15->129|1wtyA|2e-09|10.7|112/116|a.24.16.2| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111------1111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 96.5 SQ:SECSTR #ccccHHHHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHHHH#HHHTT#cccccGGGH#HHHHHTTcccHHHHHHHHHHHTTHHHHHTcGGGccHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHTTTccc# DISOP:02AL 144-145| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccc //