[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yutM
DDBJ      :yutM         putative chaperone involved in Fe-S cluster assembly
Swiss-Prot:YUTM_BACSU   RecName: Full=Uncharacterized protein yutM;

Homologs  Archaea  7/68 : Bacteria  547/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->108 2apnA PDBj 1e-17 33.3 %
:RPS:PDB   1->108 2apnA PDBj 2e-26 33.3 %
:RPS:SCOP  4->98 1r94A  b.124.1.1 * 6e-21 26.6 %
:HMM:SCOP  4->96 1nwbA_ b.124.1.1 * 3.1e-30 47.3 %
:RPS:PFM   5->96 PF01521 * Fe-S_biosyn 5e-13 31.5 %
:HMM:PFM   5->96 PF01521 * Fe-S_biosyn 2.1e-34 48.4 91/91  
:BLT:SWISS 1->120 YUTM_BACSU 8e-57 100.0 %
:PROS 91->108|PS01152|HESB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15206.1 GT:GENE yutM GT:PRODUCT putative chaperone involved in Fe-S cluster assembly GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3305599..3305961) GB:FROM 3305599 GB:TO 3305961 GB:DIRECTION - GB:GENE yutM GB:PRODUCT putative chaperone involved in Fe-S cluster assembly GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf: putative factor GB:PROTEIN_ID CAB15206.1 GB:DB_XREF GOA:O32113 HSSP:1NWB InterPro:IPR017870 SubtiList:BG14049 UniProtKB/Swiss-Prot:O32113 GB:GENE:GENE yutM LENGTH 120 SQ:AASEQ MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC GT:EXON 1|1-120:0| SW:ID YUTM_BACSU SW:DE RecName: Full=Uncharacterized protein yutM; SW:GN Name=yutM; OrderedLocusNames=BSU32160; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->120|YUTM_BACSU|8e-57|100.0|120/120| PROS 91->108|PS01152|HESB|PDOC00887| SEG 32->46|gvkgggcsglsygmg| BL:PDB:NREP 1 BL:PDB:REP 1->108|2apnA|1e-17|33.3|108/114| RP:PDB:NREP 1 RP:PDB:REP 1->108|2apnA|2e-26|33.3|108/114| RP:PFM:NREP 1 RP:PFM:REP 5->96|PF01521|5e-13|31.5|92/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 5->96|PF01521|2.1e-34|48.4|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 4->98|1r94A|6e-21|26.6|94/97|b.124.1.1| HM:SCP:REP 4->96|1nwbA_|3.1e-30|47.3|93/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 889 OP:NHOMOORG 610 OP:PATTERN ------------------------1--11-11----------------------------------11 1211111-111--1-1111-1-111-111111-----111111211-1111111111111---11-1---1-----------111111-----------1-111111111------------------------1-11111---1123233311111------12124322------------11111---1111111111111111111111111111111111------211111111111111-111111--------------------------------------------------------------------------------------------------1-----------------------11-1111111212331223233211111111111-221222211112---11-1--111321212112222111111111111--12213-1111-----111111111111111----1---1-222212222222222222222222222342222222224222223222222222221222222222112331-----------------------222221---------------------------2222211111221-1111111111111111111--2222------21222211111111111-1111111111111111111222222221111111111111111211111111-2111111111111-11----1----311212222222222222222222222222312222222122222222211111111122222222222222222222222222222212-----------------------------------------------------22- ----111-----111--1--------------------------------------------1----------1-------------1--------111----311--2-3-1111---1----2---------------11-------1---1-1--111111----1----11-121E---125444-11112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 92.5 SQ:SECSTR cccccEEccHHHHHHHHHHHHHTccccEEEEcccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHcccccccccccc######### DISOP:02AL 109-120| PSIPRED cccccEEcHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEccccccccEEEEEcccEEEEcHHHHHHHcccEEEEEEccccccEEEEcccccccccccccccccccccccccc //