[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yuxJ
DDBJ      :yuxJ         putative exporter
Swiss-Prot:YUXJ_BACSU   RecName: Full=Uncharacterized MFS-type transporter yuxJ;AltName: Full=ORF1;

Homologs  Archaea  7/68 : Bacteria  249/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:392 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  39->286 1pv6A  f.38.1.2 * 4e-14 16.8 %
:HMM:SCOP  1->386 1pv7A_ f.38.1.2 * 2.3e-65 31.0 %
:RPS:PFM   46->279 PF07690 * MFS_1 2e-12 31.4 %
:HMM:PFM   2->256 PF07690 * MFS_1 1.2e-32 25.3 245/353  
:HMM:PFM   243->381 PF07690 * MFS_1 1e-22 32.6 138/353  
:BLT:SWISS 1->392 YUXJ_BACSU 0.0 100.0 %
:TM
:REPEAT 2|1->151|208->357
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15137.2 GT:GENE yuxJ GT:PRODUCT putative exporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3232640..3233818 GB:FROM 3232640 GB:TO 3233818 GB:DIRECTION + GB:GENE yuxJ GB:PRODUCT putative exporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB15137.2 GB:DB_XREF GOA:P40760 InterPro:IPR001958 SubtiList:BG10976 UniProtKB/Swiss-Prot:P40760 GB:GENE:GENE yuxJ LENGTH 392 SQ:AASEQ MWLANFFVSASTTMIVPFLSLYIETLSSFSNGFVQRWSGYVFGITFLMAFLVSPFWGRFGDKRGYKKILMATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGFIPTSLAMISAQTPKSSAGKTLGTLQMGQVSGSLFGPLLGGMLADRFGFTYTFFITSFVIFSSVLLVLFGVKEKHLAEKTAKRTSYSRKEVLSYIFHHPALWVMMLLTMLIQTGNFSIQPLLALYVNELHGPVNLAFFSGMAFSATGLGSLLLARKWGDLGDRYGHRRILIGLLLAASFFFIPQALASSLSVLLVFRFLFGMAMGGLLPCITAAIRVQAPGSIQGEVLGYNVSFRFLGNVLGPLLGGIISSHFTISATFYVTAFLFFAGACMLWIMQKLRKDSYAKAS GT:EXON 1|1-392:0| SW:ID YUXJ_BACSU SW:DE RecName: Full=Uncharacterized MFS-type transporter yuxJ;AltName: Full=ORF1; SW:GN Name=yuxJ; Synonyms=yugC; OrderedLocusNames=BSU31480; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|YUXJ_BACSU|0.0|100.0|392/392| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 10 TM:REGION 6->28| TM:REGION 37->59| TM:REGION 68->90| TM:REGION 92->113| TM:REGION 126->148| TM:REGION 154->176| TM:REGION 205->227| TM:REGION 237->258| TM:REGION 275->297| TM:REGION 351->373| NREPEAT 1 REPEAT 2|1->151|208->357| SEG 153->168|ftytffitsfvifssv| SEG 289->304|alasslsvllvfrflf| RP:PFM:NREP 1 RP:PFM:REP 46->279|PF07690|2e-12|31.4|229/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 2->256|PF07690|1.2e-32|25.3|245/353|MFS_1| HM:PFM:REP 243->381|PF07690|1e-22|32.6|138/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 39->286|1pv6A|4e-14|16.8|244/417|f.38.1.2| HM:SCP:REP 1->386|1pv7A_|2.3e-65|31.0|378/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 361 OP:NHOMOORG 276 OP:PATTERN -------------------------------------1------1-111-----11------------ -----------------------------------------------------------------------------------------------------1--11-1-1--------------------------11111----1-1---------------------1---------------------4-2111111111111121132221112111-12122222232-11111111111111-----232111112233311111211322221111---11111111111111111111111111112111-1111---12------------22---------2----121--1---------------221------------------11-11111--1----------1--1---212222-1-111-------------------------1-----------------------------------------------1------12------1-1-1------1------------------------------------1--------------1----------1-------1-111------------------------------------------------------------2111-1-1111111111--111111111-1111111122222--222221222222222222--1---11-1-------------1-11111--1------------------------------------1----------1-------1------------------------------------------------------------------------------------------- --------42-----11-1----2-1-------------------------------11111--1-------1-1-1-------1-------1--------------1-----------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 382-392| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //