[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yuxK
DDBJ      :yuxK         conserved hypothetical protein
Swiss-Prot:YUXK_BACSU   RecName: Full=Uncharacterized protein yuxK;AltName: Full=ORF2;

Homologs  Archaea  1/68 : Bacteria  105/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:137 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->109 1bd3A  c.61.1.1 * 2e-04 26.4 %
:RPS:PFM   11->119 PF04134 * DUF393 2e-27 48.6 %
:HMM:PFM   11->120 PF04134 * DUF393 7.7e-35 39.1 110/113  
:BLT:SWISS 1->137 YUXK_BACSU 1e-78 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15139.1 GT:GENE yuxK GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3235806..3236219 GB:FROM 3235806 GB:TO 3236219 GB:DIRECTION + GB:GENE yuxK GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15139.1 GB:DB_XREF InterPro:IPR007263 SubtiList:BG10978 UniProtKB/Swiss-Prot:P40761 GB:GENE:GENE yuxK LENGTH 137 SQ:AASEQ MTSEQIPNRVLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRFDSFVFIEDGQVYTKSTAAIKVFRHLRGPWRLFVLFFAVPKPVRDMVYSFIAKNRYKWFGKKNECMLPSPSIKKRFLP GT:EXON 1|1-137:0| SW:ID YUXK_BACSU SW:DE RecName: Full=Uncharacterized protein yuxK;AltName: Full=ORF2; SW:GN Name=yuxK; Synonyms=yugD; OrderedLocusNames=BSU31500; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|YUXK_BACSU|1e-78|100.0|137/137| RP:PFM:NREP 1 RP:PFM:REP 11->119|PF04134|2e-27|48.6|109/113|DUF393| HM:PFM:NREP 1 HM:PFM:REP 11->120|PF04134|7.7e-35|39.1|110/113|DUF393| RP:SCP:NREP 1 RP:SCP:REP 12->109|1bd3A|2e-04|26.4|87/224|c.61.1.1| OP:NHOMO 154 OP:NHOMOORG 127 OP:PATTERN ---------------------------1---------------------------------------- --------------1------1------------------------------------------------------------------11---------1-1111-1-----------------11--111--1-1----------1----------------1-----------------------------1--------------1111111---1111111------1------------------------------------------------------------------------------------------------------------------------------------------------111--------111--------------------11-11-1---------112111--------1------1---------------------------------------------------------------------------------------111---------------------------------1---------------------------1------------------------------------1--1------1------1-11--1--------------------------------------------------------------------------1----------11111111111---1-----------1----------------------------1-----1-11-----111------------------------1111111---1111----111111----------------------------------------------1-- ----21------------------------------------------------------------------------------------------------------61------------------------------------------------------------------111D1111122-2-22-21---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccccEEEEcccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHcccccccccEEEEEcccEEEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccc //