[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yuzB
DDBJ      :yuzB         conserved hypothetical protein
Swiss-Prot:YUZB_BACSU   RecName: Full=UPF0349 protein yuzB;

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->74 PF07293 * DUF1450 3e-21 61.4 %
:HMM:PFM   1->78 PF07293 * DUF1450 4.6e-45 76.9 78/78  
:BLT:SWISS 1->78 YUZB_BACSU 4e-43 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15209.1 GT:GENE yuzB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3308368..3308604) GB:FROM 3308368 GB:TO 3308604 GB:DIRECTION - GB:GENE yuzB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15209.1 GB:DB_XREF InterPro:IPR009910 SubtiList:BG14051 UniProtKB/Swiss-Prot:O32116 GB:GENE:GENE yuzB LENGTH 78 SQ:AASEQ MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGETPAELVENIYTFIEENPMF GT:EXON 1|1-78:0| SW:ID YUZB_BACSU SW:DE RecName: Full=UPF0349 protein yuzB; SW:GN Name=yuzB; OrderedLocusNames=BSU32190; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->78|YUZB_BACSU|4e-43|100.0|78/78| RP:PFM:NREP 1 RP:PFM:REP 5->74|PF07293|3e-21|61.4|70/72|DUF1450| HM:PFM:NREP 1 HM:PFM:REP 1->78|PF07293|4.6e-45|76.9|78/78|DUF1450| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-11111-1111111111-1111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 78-79| PSIPRED ccccHHHHHHHHcccHHHHHHHHHHccccEEEEEccccccHHHHcccEEEEcccEEEcccHHHHHHHHHHHHHHcccc //