[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yvbX
DDBJ      :yvbX         putative epimerase modification of peptidoglycan
Swiss-Prot:YVBX_BACSU   RecName: Full=Uncharacterized glycosylase yvbX;         EC=3.2.-.-;Flags: Precursor;

Homologs  Archaea  1/68 : Bacteria  110/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->328 3cz8A PDBj 6e-30 27.1 %
:RPS:PDB   37->329 3cz8B PDBj 2e-33 23.9 %
:RPS:SCOP  80->344 1e15A2  c.1.8.5 * 2e-22 15.2 %
:HMM:SCOP  29->338 1e9lA1 c.1.8.5 * 1.1e-40 27.0 %
:RPS:PFM   107->329 PF00704 * Glyco_hydro_18 2e-19 30.5 %
:HMM:PFM   74->330 PF00704 * Glyco_hydro_18 8.6e-39 28.1 242/342  
:BLT:SWISS 1->344 YVBX_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15407.1 GT:GENE yvbX GT:PRODUCT putative epimerase modification of peptidoglycan GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3491655..3492689) GB:FROM 3491655 GB:TO 3492689 GB:DIRECTION - GB:GENE yvbX GB:PRODUCT putative epimerase modification of peptidoglycan GB:FUNCTION 16.13: Shape 16.6: Maintain 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12177332; Product type pe : putative enzyme GB:PROTEIN_ID CAB15407.1 GB:DB_XREF GOA:O32258 InterPro:IPR013781 SubtiList:BG14090 UniProtKB/Swiss-Prot:O32258 GB:GENE:GENE yvbX LENGTH 344 SQ:AASEQ MKKWLIIAVSLAIAIVLFMYTKGEAKAAGMTVGYTTGDTASYNSLTKYHTYMNAIATDTFAFEKNGQIIGDAPTKQLTYAKKKKIKTWAVISNYNDAIYDFDGDLASRVMSNKTAKKRFTDQLITLAKKHSYYGINIDFEAVNPEDRAAYSNFIQYVSQALNKKHIKTMVSVPAKSADDKNDDWSWPYDYAKIGKYADFVQVMTYDEHGIWGEPGSVASTNWIKSSLQFSVKKIKANKVIMGIPAYGYDWDVKDGSTSTIREWNELKSLIKKQKAKPAFNKKSGSMTFSYVDKKKHKHVVWYENEKTVQTKSHLAKQYKIAGVSVYALGNESESFWKAIRKGTK GT:EXON 1|1-344:0| SW:ID YVBX_BACSU SW:DE RecName: Full=Uncharacterized glycosylase yvbX; EC=3.2.-.-;Flags: Precursor; SW:GN Name=yvbX; OrderedLocusNames=BSU34020; SW:KW Complete proteome; Glycosidase; Hydrolase; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->344|YVBX_BACSU|0.0|100.0|344/344| GO:SWS:NREP 3 GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| TM:NTM 1 TM:REGION 4->20| SEG 5->17|liiavslaiaivl| SEG 271->282|kkqkakpafnkk| BL:PDB:NREP 1 BL:PDB:REP 34->328|3cz8A|6e-30|27.1|288/302| RP:PDB:NREP 1 RP:PDB:REP 37->329|3cz8B|2e-33|23.9|289/298| RP:PFM:NREP 1 RP:PFM:REP 107->329|PF00704|2e-19|30.5|203/309|Glyco_hydro_18| HM:PFM:NREP 1 HM:PFM:REP 74->330|PF00704|8.6e-39|28.1|242/342|Glyco_hydro_18| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00704|IPR001223| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00704|IPR001223| RP:SCP:NREP 1 RP:SCP:REP 80->344|1e15A2|2e-22|15.2|244/356|c.1.8.5| HM:SCP:REP 29->338|1e9lA1|1.1e-40|27.0|244/0|c.1.8.5|1/1|(Trans)glycosidases| OP:NHOMO 233 OP:NHOMOORG 146 OP:PATTERN ----------------------------------------------------------------1--- 211-1-----------------------------------1---------1-----------1---1---------------------------------------------------------------------11111---11---------------------------------------------3-221212112121222211221422113331--------44-------------------------------------------------------------------------------------------122-1111111-1-3-111---313--4112-33111121-1213----2--1--------------------------------------1------------------------------------------------------------1-------------------11-1--------------------------------------------------------1-------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------111111111111----113322------------------------------------------------- ------1------1--------------------1--1-1-11------1--1-1--1------------------------------------------1---------------2--1--------1-5--2-1-1--------1------4--1-1---11232112F-----1--------1-------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 320 STR:RPRED 93.0 SQ:SECSTR ########################ccccccEEEEcTcEEEEEEEEEcGGGcccEEEEEEEEccTTccccccccHHHHHHHHHTTcEEEEEEEcEETTHHEEcHHHHHHHHHcHHHHHHHHHHHHHHHHHHTccEEEEEcccccGGGHHHHHHHHHHHHHHHHHTTcEEEEEEEcccccccccGGGTTccHHHHHHHccEEEEEccccccTTccccccccHHHHHHHHHHHHTTccGGGEEEEccccEEEEEccccTTcccEEEHHHHHHHHHTTcccEEETTTTEEEEEEEcTTccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEEcccGGGGGGcHHHHH DISOP:02AL 344-345| PSIPRED cccHHHHHHHHHHHHHHcccccccHHcccEEEEEEccccHHHHHHHHHHccccEEEEEEEEEcccccccccccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHcccHHHHHHHccEEEEEEcccccccccccccccccHHHHHHHHHHccccHHHEEEEEEcccEEEEcccccccccccHHHHHHHHHHccccEEEccccccEEEEEEEccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccc //