[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yvcS
DDBJ      :yvcS         putative ABC transporter (permease)
Swiss-Prot:YVCS_BACSU   RecName: Full=Uncharacterized ABC transporter permease yvcS;

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:646 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->181 PF02687 * FtsX 7.7e-16 24.8 125/175  
:HMM:PFM   492->626 PF02687 * FtsX 2e-10 17.8 129/175  
:BLT:SWISS 1->646 YVCS_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15474.1 GT:GENE yvcS GT:PRODUCT putative ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3563581..3565521) GB:FROM 3563581 GB:TO 3565521 GB:DIRECTION - GB:GENE yvcS GB:PRODUCT putative ABC transporter (permease) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB15474.1 GB:DB_XREF GOA:O06981 InterPro:IPR003838 SubtiList:BG12408 UniProtKB/Swiss-Prot:O06981 GB:GENE:GENE yvcS LENGTH 646 SQ:AASEQ MNLRTIARKNILGNLQRYVAYFLSCVFAVSVFFVFTSFIFHPDVNEDNIYGGSLVKTCLSAALVVIIVFCIFFITYSNSAFLQARKKEFGLLTLFGTSKQQLRKMIYYEQSLISLAAIAAGIGAGLLFSKLFFMIMTWMLSVKVPISFAIVPKAFVMTIAGFLILFQTLLILSLGRIRKLEIIELIKSAKKPKSLPVYSKWLTVLSLLCLGSGYYLSATANAIDMMFRVFPILILVLIGTYFFFTQSSVAFFRMLYRKKHSFYKGTNIIVRSNMIFRLKDHARMLFLTSVITAVILTATGVIYMFYSDLQRQEEQSIPQSVSWVEKDASRFQVMKPETAENTLKKAHAVITYKVDATGIPVTFQSDLPYGNKKMEAEALLISEKVYNQVAKEKGFPVIHLQENEAFINVSFQMMVKDTFGEGETAAFHMKSGKTLSYVMKKQQNKGILMSVDGVSRLLVVSEKSFDSLSQDVPLKEQMRMVGYELEHWQETVDVSEKLENMVPKEHTSDFQTRAPSYQIVKQGVALMLFIGLFVSVLFFIVQGSMLYLRMFTEIEDTGVQVLALKRIGVTDKEIHSILGKQIGFLFFIPFIAGTIHAGFAYAALSNMLNSNLFLEAVIVIFIYFVFQALYYIVTRHIYKRAVLQRM GT:EXON 1|1-646:0| SW:ID YVCS_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter permease yvcS; SW:GN Name=yvcS; OrderedLocusNames=BSU34690; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->646|YVCS_BACSU|0.0|100.0|646/646| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 10 TM:REGION 19->41| TM:REGION 54->76| TM:REGION 111->133| TM:REGION 155->176| TM:REGION 194->216| TM:REGION 222->244| TM:REGION 284->306| TM:REGION 522->544| TM:REGION 580->602| TM:REGION 613->635| SEG 22->40|flscvfavsvffvftsfif| SEG 64->74|vviivfciffi| SEG 111->127|slislaaiaagigagll| SEG 162->174|flilfqtllilsl| SEG 205->217|lsllclgsgyyls| HM:PFM:NREP 2 HM:PFM:REP 55->181|PF02687|7.7e-16|24.8|125/175|FtsX| HM:PFM:REP 492->626|PF02687|2e-10|17.8|129/175|FtsX| OP:NHOMO 286 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------344A4A9894B9888A233313AAB-11311122222123-11111111111111122112---11--11-----111--11----111---11--------------------------2-1---1111-412-3335334242-411-111121--------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 43-55, 184-199| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccEEEEEcHHHHHHHHHcccccccccccEEEEEEccccccHHHHccccccccEEcccEEEEEEEccEEEEcEEEEEcccEEEEEEcHHHHHHHHHHcccccEEEEEEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //