[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yvgO
DDBJ      :yvgO         conserved hypothetical protein
Swiss-Prot:YVGO_BACSU   RecName: Full=Stress response protein yvgO;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->95 PF05802 * EspB 0.00046 25.9 81/317  
:BLT:SWISS 1->161 YVGO_BACSU 4e-87 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15346.1 GT:GENE yvgO GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3427802..3428287 GB:FROM 3427802 GB:TO 3428287 GB:DIRECTION + GB:GENE yvgO GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 11988534 GB:PROTEIN_ID CAB15346.1 GB:DB_XREF GOA:O32211 SubtiList:BG14097 UniProtKB/Swiss-Prot:O32211 GB:GENE:GENE yvgO LENGTH 161 SQ:AASEQ MKRIRIPMTLALGAALTIAPLSFASAEENPAPKMSQTTTAGTTAADVGLNVNLDVLGIANQIADAIKSAQNRDGFVKNLMESSFYASGQKYNVMVFNLSQEYEDHLNGVQFYGSAVYDGITYGIWVFEDGTFTNKGDGGWINWAFRGWFDRDGSTVAFHRP GT:EXON 1|1-161:0| SW:ID YVGO_BACSU SW:DE RecName: Full=Stress response protein yvgO;Flags: Precursor; SW:GN Name=yvgO; OrderedLocusNames=BSU33410; SW:KW Complete proteome; Signal; Stress response. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->161|YVGO_BACSU|4e-87|100.0|161/100| GO:SWS:NREP 1 GO:SWS GO:0006950|"GO:response to stress"|Stress response| SEG 37->45|tttagttaa| HM:PFM:NREP 1 HM:PFM:REP 15->95|PF05802|0.00046|25.9|81/317|EspB| OP:NHOMO 8 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------1121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 22-40, 156-158, 160-161| PSIPRED cEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccEEEEEEEEccHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEEEEcccHHHccccEEEEEEcEEEccEEEEEEEEEcccccccccccEEEEEEEEEEEccccEEEEEcc //