[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yviE
DDBJ      :yviE         conserved hypothetical protein
Swiss-Prot:YVIE_BACSU   RecName: Full=Uncharacterized protein yviE;

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->191 YVIE_BACSU e-108 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15556.1 GT:GENE yviE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3636716..3637291) GB:FROM 3636716 GB:TO 3637291 GB:DIRECTION - GB:GENE yviE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 15033535 GB:PROTEIN_ID CAB15556.1 GB:DB_XREF SubtiList:BG12450 UniProtKB/Swiss-Prot:P96502 GB:GENE:GENE yviE LENGTH 191 SQ:AASEQ MQIPRLIMHSVQGKIGLTTTPASLKMEQPQADLEIEQPSAEMEISVTPGKLTIDQTQAWEELDRKHVFKRIEEAAQQGHEDVMEGIARTAEEGDELMKIENKGNPIASQARRNSEMHQIQLGENYAPSLSRVKIQYTPSQLDVQITPRKPVIQAEPHKPIVEYTPGNVKVDMLQYPDLNIDVEYPKESPEK GT:EXON 1|1-191:0| SW:ID YVIE_BACSU SW:DE RecName: Full=Uncharacterized protein yviE; SW:GN Name=yviE; OrderedLocusNames=BSU35390; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->191|YVIE_BACSU|e-108|100.0|191/191| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------11111---1111111------11---------------------------------------------------------------------------------------------------------1---------1-------11-----1--111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 24-33, 109-116, 186-191| PSIPRED ccccEEEEEEEcccEEEEEcccccEEEEccccEEEEEccccEEEEEEccEEEEEHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHccccccEEEccEEcccccccEEEEcccEEEEEEEEccEEEEEEccEEEEEEEccEEEEEEEEcccEEEEEEcccccccc //