[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yvrO
DDBJ      :yvrO         putative ABC transporter (ATP-binding protein)
Swiss-Prot:YVRO_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein yvrO;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:229 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->223 1l2tB PDBj 1e-64 52.5 %
:RPS:PDB   2->219 3b5jA PDBj 4e-52 31.2 %
:RPS:SCOP  1->219 1b0uA  c.37.1.12 * 6e-48 35.8 %
:HMM:SCOP  4->219 1ii8.1 c.37.1.12 * 6.1e-67 39.8 %
:RPS:PFM   45->169 PF00005 * ABC_tran 2e-21 45.8 %
:HMM:PFM   45->169 PF00005 * ABC_tran 1.5e-29 40.5 116/118  
:HMM:PFM   23->51 PF03193 * DUF258 8e-06 28.6 28/161  
:BLT:SWISS 1->229 YVRO_BACSU e-128 100.0 %
:PROS 142->156|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15318.2 GT:GENE yvrO GT:PRODUCT putative ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3413350..3414039) GB:FROM 3413350 GB:TO 3414039 GB:DIRECTION - GB:GENE yvrO GB:PRODUCT putative ABC transporter (ATP-binding protein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 11544226; Product type pt : putative transporter GB:PROTEIN_ID CAB15318.2 GB:DB_XREF GOA:O34979 HSSP:1F3O InterPro:IPR003593 SubtiList:BG14151 UniProtKB/Swiss-Prot:O34979 GB:GENE:GENE yvrO LENGTH 229 SQ:AASEQ MLTLNNISKSYKLGKEEVPILKHINLTVQAGEFLAIMGPSGSGKSTLMNIIGCLDRPTSGTYTLDQIDILKGKDGALAEIRNESIGFVFQTFHLLPRLTALQNVELPMIYNKVKKKERRQRAYEALEKVGLKDRVSYKPPKLSGGQKQRVAIARALVNQPRFILADEPTGALDTKSSEQILALFSELHREGKTIIMITHDPDVAKKADRTVFIRDGELVLDERGDISHA GT:EXON 1|1-229:0| SW:ID YVRO_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein yvrO; EC=3.6.3.-; SW:GN Name=yvrO; OrderedLocusNames=BSU33270; SW:KW ATP-binding; Complete proteome; Hydrolase; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->229|YVRO_BACSU|e-128|100.0|229/229| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->223|1l2tB|1e-64|52.5|223/232| RP:PDB:NREP 1 RP:PDB:REP 2->219|3b5jA|4e-52|31.2|215/243| RP:PFM:NREP 1 RP:PFM:REP 45->169|PF00005|2e-21|45.8|118/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 45->169|PF00005|1.5e-29|40.5|116/118|ABC_tran| HM:PFM:REP 23->51|PF03193|8e-06|28.6|28/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->219|1b0uA|6e-48|35.8|215/258|c.37.1.12| HM:SCP:REP 4->219|1ii8.1|6.1e-67|39.8|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 56095 OP:NHOMOORG 1174 OP:PATTERN VVPBULJLZYaWZVbPnKSRPSRbzPSkocgXJDEEFBHGHFCWcTXnNT**n8VhVYZPVLLGa1AC YfxP*jikttwejVYUYON-NmBBY*OOOOOPwsru****a*a****ixrhV**zUXnHH***p*v****fefff*ifjR*lpCBEACWWWR8RGLM--FHYOONiSePX9CBBBBCDDDCCCCKVTNRcROYUdUv****LKK*b*rx*kkrimYZSMQNTNkldo***kNWKNPONWMNKNncjSR*qCWg*************************kr***oy***zyz**duvwuwsrtuuuuttfidii*ocf**fQkbuyxTU**daWbqnqoryy**yv****y*yyuvz*w*yijjiijnmnkjij*tskjjusvru***********n*o****fmpj*wl***mwVN***rcglpUYnfvpQgfkPfbXXPNPNMOgY***dXx****************-uw*pm*t***WE**************NLQ**********TSTTTTTT*eiNUka*66577777668898DEA9BB99AAA86A6LFFHFG************************x********CP**z*t*rx******esqPaMWscMNKJKKKVTShqni**Sla*scmygesOgdcVadpZcaaXav*a*ONMTHOOOPNKDEFGHGFGFIYHINSR*z*X*YlOYR*WbefcTbjaYZcbbfafii7-EObTP331333****f************-************************xwnyyswwwwwxwuuyuwv**vx****b4************54MJFIFFGRSUSUM*y*gffeffNTWSPYSYkPRTSRHUIQWyf********z****m***HGGEFJHFGOnyx*xyyyy*****VWXUUVUSUVIHHHAAQVXXMNMNB9799999*EfFDEEF-IHGGLJFRQOCJNELK99Cer*bcv*xwuFlQ 2278vmM-gOBDWiVQKQKNRWTZRbTMLGIIISPPIQLOJNMFGFLOSYYUmaQPRFJKKKEBI6974AC6GDI8C2A8EFCBEM78-LR9KGBKGCCCD9IRKM8XlsydmbrioOLJEJcM*xF*G**s4vYxLOKIiHOreJTNIFhFG*IgYVyQv*P*WmH*gq*wqcQJOKJ*GKGLW*x**M**MR*v**T ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 221-229| PSIPRED cEEEEEEEEEEccccEEEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEccccccccc //